6.26.2. Phrase translation Test

Here's the table.
EnglishSpanishGermanItalian
0000-007f Basic Latin0000-007f Basic Latin0000-007f Basic Latin0000-007f Basic Latin
0080-00ff Latin-1 Supplement0080-00ff Latin-1 Supplement0080-00ff Latin-1 Supplement0080-00ff Latin-1 Supplement
0100-017f Latin Extended-A0100-017f Latin Extended-A0100-017f Latin Extended-A0100-017f Latin Extended-A
0180-024f Latin Extended-B0180-024f Latin Extended-B0180-024f Latin Extended-B0180-024f Latin Extended-B
0250-02af IPA Extensions0250-02af IPA Extensions0250-02af IPA Extensions0250-02af IPA Extensions
02b0-02ff Spacing Modifier Letters02b0-02ff Spacing Modifier Letters02b0-02ff Spacing Modifier Letters02b0-02ff Spacing Modifier Letters
0300-036f Combining Diacritical Marks0300-036f Combining Diacritical Marks0300-036f Combining Diacritical Marks0300-036f Combining Diacritical Marks
0370-03ff Greek0370-03ff Greek0370-03ff Greek0370-03ff Greek
0400-04ff Cyrillic0400-04ff Cyrillic0400-04ff Cyrillic0400-04ff Cyrillic
0530-058f Armenian0530-058f Armenian0530-058f Armenian0530-058f Armenian
0590-05ff Hebrew0590-05ff Hebrew0590-05ff Hebrew0590-05ff Hebrew
0600-06ff Arabic0600-06ff Arabic0600-06ff Arabic0600-06ff Arabic
0900-097f Devanagari0900-097f Devanagari0900-097f Devanagari0900-097f Devanagari
0980-09ff Bengali0980-09ff Bengali0980-09ff Bengali0980-09ff Bengali
0a00-0a7f Gurmukhi0a00-0a7f Gurmukhi0a00-0a7f Gurmukhi0a00-0a7f Gurmukhi
0a80-0aff Gujarati0a80-0aff Gujarati0a80-0aff Gujarati0a80-0aff Gujarati
0b00-0b7f Oriya0b00-0b7f Oriya0b00-0b7f Oriya0b00-0b7f Oriya
0b80-0bff Tamil0b80-0bff Tamil0b80-0bff Tamil0b80-0bff Tamil
0c00-0c7f Telugu0c00-0c7f Telugu0c00-0c7f Telugu0c00-0c7f Telugu
0c80-0cff Kannada0c80-0cff Kannada0c80-0cff Kannada0c80-0cff Kannada
0d00-0d7f Malayalam0d00-0d7f Malayalam0d00-0d7f Malayalam0d00-0d7f Malayalam
0e00-0e7f Thai0e00-0e7f Thai0e00-0e7f Thai0e00-0e7f Thai
0e80-0eff Lao0e80-0eff Lao0e80-0eff Lao0e80-0eff Lao
0f00-0fbf Tibetan0f00-0fbf Tibetan0f00-0fbf Tibetan0f00-0fbf Tibetan
10a0-10ff Georgian10a0-10ff Georgian10a0-10ff Georgian10a0-10ff Georgian
1100-11ff Hangul Jamo1100-11ff Hangul Jamo1100-11ff Hangul Jamo1100-11ff Hangul Jamo
1e00-1eff Latin Extended Additional1e00-1eff Latin Extended Additional1e00-1eff Latin Extended Additional1e00-1eff Latin Extended Additional
1f00-1fff Greek Extended1f00-1fff Greek Extended1f00-1fff Greek Extended1f00-1fff Greek Extended
2000-206f General Punctuation2000-206f General Punctuation2000-206f General Punctuation2000-206f General Punctuation
2070-209f Superscripts and Subscripts2070-209f Superscripts and Subscripts2070-209f Superscripts and Subscripts2070-209f Superscripts and Subscripts
20a0-20cf Currency Symbols20a0-20cf Currency Symbols20a0-20cf Currency Symbols20a0-20cf Currency Symbols
20d0-20ff Combining Marks for Symbols20d0-20ff Combining Marks for Symbols20d0-20ff Combining Marks for Symbols20d0-20ff Combining Marks for Symbols
2100-214f Letterlike Symbols2100-214f Letterlike Symbols2100-214f Letterlike Symbols2100-214f Letterlike Symbols
2150-218f Number Forms2150-218f Number Forms2150-218f Number Forms2150-218f Number Forms
2190-21ff Arrows2190-21ff Arrows2190-21ff Arrows2190-21ff Arrows
2200-22ff Mathematical Operators2200-22ff Mathematical Operators2200-22ff Mathematical Operators2200-22ff Mathematical Operators
2300-23ff Miscellaneous Technical2300-23ff Miscellaneous Technical2300-23ff Miscellaneous Technical2300-23ff Miscellaneous Technical
2400-243f Control Pictures2400-243f Control Pictures2400-243f Control Pictures2400-243f Control Pictures
2440-245f Optical Character Recognition2440-245f Optical Character Recognition2440-245f Optical Character Recognition2440-245f Optical Character Recognition
2460-24ff Enclosed Alphanumerics2460-24ff Enclosed Alphanumerics2460-24ff Enclosed Alphanumerics2460-24ff Enclosed Alphanumerics
2500-257f Box Drawing2500-257f Box Drawing2500-257f Box Drawing2500-257f Box Drawing
2580-259f Block Elements2580-259f Block Elements2580-259f Block Elements2580-259f Block Elements
25a0-25ff Geometric Shapes25a0-25ff Geometric Shapes25a0-25ff Geometric Shapes25a0-25ff Geometric Shapes
2600-26ff Miscellaneous Symbols2600-26ff Miscellaneous Symbols2600-26ff Miscellaneous Symbols2600-26ff Miscellaneous Symbols
2700-27bf Dingbats2700-27bf Dingbats2700-27bf Dingbats2700-27bf Dingbats
3000-303f CJK Symbols and Punctuation3000-303f CJK Symbols and Punctuation3000-303f CJK Symbols and Punctuation3000-303f CJK Symbols and Punctuation
3040-309f Hiragana3040-309f Hiragana3040-309f Hiragana3040-309f Hiragana
30a0-30ff Katakana30a0-30ff Katakana30a0-30ff Katakana30a0-30ff Katakana
3100-312f Bopomofo3100-312f Bopomofo3100-312f Bopomofo3100-312f Bopomofo
3130-318f Hangul Compatibility Jamo3130-318f Hangul Compatibility Jamo3130-318f Hangul Compatibility Jamo3130-318f Hangul Compatibility Jamo
3190-319f Kanbun3190-319f Kanbun3190-319f Kanbun3190-319f Kanbun
3200-32ff Enclosed CJK Letters and Months3200-32ff Enclosed CJK Letters and Months3200-32ff Enclosed CJK Letters and Months3200-32ff Enclosed CJK Letters and Months
3300-33ff CJK Compatibility3300-33ff CJK Compatibility3300-33ff CJK Compatibility3300-33ff CJK Compatibility
4e00-9fff CJK Unified Ideographs4e00-9fff CJK Unified Ideographs4e00-9fff CJK Unified Ideographs4e00-9fff CJK Unified Ideographs
8 bit Microsoft/IBM code pages8 bit Microsoft/IBM code pages8 bit Microsoft/IBM code pages8 bit Microsoft/IBM code pages
A break testA break testA break testA break test
A diff OK testA diff OK testA diff OK testA diff OK test
A diff fail testA diff fail testA diff fail testA diff fail test
A documentA documentA documentA document
A python testA python testA python testA python test
ASCII subrangeASCII subrangeASCII subrangeASCII subrange
AccessorsAccessorsAccessorsAccessors
Advanced Web WeavingAdvanced Web WeavingAdvanced Web WeavingAdvanced Web Weaving
AnchorsAnchorsAnchorsAnchors
AppendicesAppendicesAppendicesAppendices
Application and tool directoryApplication and tool directoryApplication and tool directoryApplication and tool directory
Arabic Presentation Forms-A fb50-fc4fArabic Presentation Forms-A fb50-fc4fArabic Presentation Forms-A fb50-fc4fArabic Presentation Forms-A fb50-fc4f
Arabic Presentation Forms-A fc00-fcffArabic Presentation Forms-A fc00-fcffArabic Presentation Forms-A fc00-fcffArabic Presentation Forms-A fc00-fcff
Arabic Presentation Forms-A fd00-fdffArabic Presentation Forms-A fd00-fdffArabic Presentation Forms-A fd00-fdffArabic Presentation Forms-A fd00-fdff
ArchitectureArchitectureArchitectureArchitecture
Argument FrameArgument FrameArgument FrameArgument Frame
Augment grammarAugment grammarAugment grammarAugment grammar
Automatic heading numberingAutomatic heading numberingAutomatic heading numberingAutomatic heading numbering
Automatic pagination on headingsAutomatic pagination on headingsAutomatic pagination on headingsAutomatic pagination on headings
Automatic table generationAutomatic table generationAutomatic table generationAutomatic table generation
Basic Output OperationsBasic Output OperationsBasic Output OperationsBasic Output Operations
Basic font selectionBasic font selectionBasic font selectionBasic font selection
Begin the TableBegin the TableBegin the TableBegin the Table
Begin/end testBegin/end testBegin/end testBegin/end test
Bidirectional PropertiesBidirectional PropertiesBidirectional PropertiesBidirectional Properties
Big5 MappingBig5 MappingBig5 MappingBig5 Mapping
Big5 lead byte 0xa1.Big5 lead byte 0xa1.Big5 lead byte 0xa1.Big5 lead byte 0xa1.
Big5 lead byte 0xa2.Big5 lead byte 0xa2.Big5 lead byte 0xa2.Big5 lead byte 0xa2.
Big5 lead byte 0xa3.Big5 lead byte 0xa3.Big5 lead byte 0xa3.Big5 lead byte 0xa3.
Big5 lead byte 0xa4.Big5 lead byte 0xa4.Big5 lead byte 0xa4.Big5 lead byte 0xa4.
Big5 lead byte 0xa5.Big5 lead byte 0xa5.Big5 lead byte 0xa5.Big5 lead byte 0xa5.
Big5 lead byte 0xa6.Big5 lead byte 0xa6.Big5 lead byte 0xa6.Big5 lead byte 0xa6.
Big5 lead byte 0xa7.Big5 lead byte 0xa7.Big5 lead byte 0xa7.Big5 lead byte 0xa7.
Big5 lead byte 0xa8.Big5 lead byte 0xa8.Big5 lead byte 0xa8.Big5 lead byte 0xa8.
Big5 lead byte 0xa9.Big5 lead byte 0xa9.Big5 lead byte 0xa9.Big5 lead byte 0xa9.
Big5 lead byte 0xaa.Big5 lead byte 0xaa.Big5 lead byte 0xaa.Big5 lead byte 0xaa.
Big5 lead byte 0xab.Big5 lead byte 0xab.Big5 lead byte 0xab.Big5 lead byte 0xab.
Big5 lead byte 0xac.Big5 lead byte 0xac.Big5 lead byte 0xac.Big5 lead byte 0xac.
Big5 lead byte 0xad.Big5 lead byte 0xad.Big5 lead byte 0xad.Big5 lead byte 0xad.
Big5 lead byte 0xae.Big5 lead byte 0xae.Big5 lead byte 0xae.Big5 lead byte 0xae.
Big5 lead byte 0xaf.Big5 lead byte 0xaf.Big5 lead byte 0xaf.Big5 lead byte 0xaf.
Big5 lead byte 0xb0.Big5 lead byte 0xb0.Big5 lead byte 0xb0.Big5 lead byte 0xb0.
Big5 lead byte 0xb1.Big5 lead byte 0xb1.Big5 lead byte 0xb1.Big5 lead byte 0xb1.
Big5 lead byte 0xb2.Big5 lead byte 0xb2.Big5 lead byte 0xb2.Big5 lead byte 0xb2.
Big5 lead byte 0xb3.Big5 lead byte 0xb3.Big5 lead byte 0xb3.Big5 lead byte 0xb3.
Big5 lead byte 0xb4.Big5 lead byte 0xb4.Big5 lead byte 0xb4.Big5 lead byte 0xb4.
Big5 lead byte 0xb5.Big5 lead byte 0xb5.Big5 lead byte 0xb5.Big5 lead byte 0xb5.
Big5 lead byte 0xb6.Big5 lead byte 0xb6.Big5 lead byte 0xb6.Big5 lead byte 0xb6.
Big5 lead byte 0xb7.Big5 lead byte 0xb7.Big5 lead byte 0xb7.Big5 lead byte 0xb7.
Big5 lead byte 0xb8.Big5 lead byte 0xb8.Big5 lead byte 0xb8.Big5 lead byte 0xb8.
Big5 lead byte 0xb9.Big5 lead byte 0xb9.Big5 lead byte 0xb9.Big5 lead byte 0xb9.
Big5 lead byte 0xba.Big5 lead byte 0xba.Big5 lead byte 0xba.Big5 lead byte 0xba.
Big5 lead byte 0xbb.Big5 lead byte 0xbb.Big5 lead byte 0xbb.Big5 lead byte 0xbb.
Big5 lead byte 0xbc.Big5 lead byte 0xbc.Big5 lead byte 0xbc.Big5 lead byte 0xbc.
Big5 lead byte 0xbd.Big5 lead byte 0xbd.Big5 lead byte 0xbd.Big5 lead byte 0xbd.
Big5 lead byte 0xbe.Big5 lead byte 0xbe.Big5 lead byte 0xbe.Big5 lead byte 0xbe.
Big5 lead byte 0xbf.Big5 lead byte 0xbf.Big5 lead byte 0xbf.Big5 lead byte 0xbf.
Big5 lead byte 0xc0.Big5 lead byte 0xc0.Big5 lead byte 0xc0.Big5 lead byte 0xc0.
Big5 lead byte 0xc1.Big5 lead byte 0xc1.Big5 lead byte 0xc1.Big5 lead byte 0xc1.
Big5 lead byte 0xc2.Big5 lead byte 0xc2.Big5 lead byte 0xc2.Big5 lead byte 0xc2.
Big5 lead byte 0xc3.Big5 lead byte 0xc3.Big5 lead byte 0xc3.Big5 lead byte 0xc3.
Big5 lead byte 0xc4.Big5 lead byte 0xc4.Big5 lead byte 0xc4.Big5 lead byte 0xc4.
Big5 lead byte 0xc5.Big5 lead byte 0xc5.Big5 lead byte 0xc5.Big5 lead byte 0xc5.
Big5 lead byte 0xc6.Big5 lead byte 0xc6.Big5 lead byte 0xc6.Big5 lead byte 0xc6.
Big5 lead byte 0xc7.Big5 lead byte 0xc7.Big5 lead byte 0xc7.Big5 lead byte 0xc7.
Big5 lead byte 0xc8.Big5 lead byte 0xc8.Big5 lead byte 0xc8.Big5 lead byte 0xc8.
Big5 lead byte 0xc9.Big5 lead byte 0xc9.Big5 lead byte 0xc9.Big5 lead byte 0xc9.
Big5 lead byte 0xca.Big5 lead byte 0xca.Big5 lead byte 0xca.Big5 lead byte 0xca.
Big5 lead byte 0xcb.Big5 lead byte 0xcb.Big5 lead byte 0xcb.Big5 lead byte 0xcb.
Big5 lead byte 0xcc.Big5 lead byte 0xcc.Big5 lead byte 0xcc.Big5 lead byte 0xcc.
Big5 lead byte 0xcd.Big5 lead byte 0xcd.Big5 lead byte 0xcd.Big5 lead byte 0xcd.
Big5 lead byte 0xce.Big5 lead byte 0xce.Big5 lead byte 0xce.Big5 lead byte 0xce.
Big5 lead byte 0xcf.Big5 lead byte 0xcf.Big5 lead byte 0xcf.Big5 lead byte 0xcf.
Big5 lead byte 0xd0.Big5 lead byte 0xd0.Big5 lead byte 0xd0.Big5 lead byte 0xd0.
Big5 lead byte 0xd1.Big5 lead byte 0xd1.Big5 lead byte 0xd1.Big5 lead byte 0xd1.
Big5 lead byte 0xd2.Big5 lead byte 0xd2.Big5 lead byte 0xd2.Big5 lead byte 0xd2.
Big5 lead byte 0xd3.Big5 lead byte 0xd3.Big5 lead byte 0xd3.Big5 lead byte 0xd3.
Big5 lead byte 0xd4.Big5 lead byte 0xd4.Big5 lead byte 0xd4.Big5 lead byte 0xd4.
Big5 lead byte 0xd5.Big5 lead byte 0xd5.Big5 lead byte 0xd5.Big5 lead byte 0xd5.
Big5 lead byte 0xd6.Big5 lead byte 0xd6.Big5 lead byte 0xd6.Big5 lead byte 0xd6.
Big5 lead byte 0xd7.Big5 lead byte 0xd7.Big5 lead byte 0xd7.Big5 lead byte 0xd7.
Big5 lead byte 0xd8.Big5 lead byte 0xd8.Big5 lead byte 0xd8.Big5 lead byte 0xd8.
Big5 lead byte 0xd9.Big5 lead byte 0xd9.Big5 lead byte 0xd9.Big5 lead byte 0xd9.
Big5 lead byte 0xda.Big5 lead byte 0xda.Big5 lead byte 0xda.Big5 lead byte 0xda.
Big5 lead byte 0xdb.Big5 lead byte 0xdb.Big5 lead byte 0xdb.Big5 lead byte 0xdb.
Big5 lead byte 0xdc.Big5 lead byte 0xdc.Big5 lead byte 0xdc.Big5 lead byte 0xdc.
Big5 lead byte 0xdd.Big5 lead byte 0xdd.Big5 lead byte 0xdd.Big5 lead byte 0xdd.
Big5 lead byte 0xde.Big5 lead byte 0xde.Big5 lead byte 0xde.Big5 lead byte 0xde.
Big5 lead byte 0xdf.Big5 lead byte 0xdf.Big5 lead byte 0xdf.Big5 lead byte 0xdf.
Big5 lead byte 0xe0.Big5 lead byte 0xe0.Big5 lead byte 0xe0.Big5 lead byte 0xe0.
Big5 lead byte 0xe1.Big5 lead byte 0xe1.Big5 lead byte 0xe1.Big5 lead byte 0xe1.
Big5 lead byte 0xe2.Big5 lead byte 0xe2.Big5 lead byte 0xe2.Big5 lead byte 0xe2.
Big5 lead byte 0xe3.Big5 lead byte 0xe3.Big5 lead byte 0xe3.Big5 lead byte 0xe3.
Big5 lead byte 0xe4.Big5 lead byte 0xe4.Big5 lead byte 0xe4.Big5 lead byte 0xe4.
Big5 lead byte 0xe5.Big5 lead byte 0xe5.Big5 lead byte 0xe5.Big5 lead byte 0xe5.
Big5 lead byte 0xe6.Big5 lead byte 0xe6.Big5 lead byte 0xe6.Big5 lead byte 0xe6.
Big5 lead byte 0xe7.Big5 lead byte 0xe7.Big5 lead byte 0xe7.Big5 lead byte 0xe7.
Big5 lead byte 0xe8.Big5 lead byte 0xe8.Big5 lead byte 0xe8.Big5 lead byte 0xe8.
Big5 lead byte 0xe9.Big5 lead byte 0xe9.Big5 lead byte 0xe9.Big5 lead byte 0xe9.
Big5 lead byte 0xea.Big5 lead byte 0xea.Big5 lead byte 0xea.Big5 lead byte 0xea.
Big5 lead byte 0xeb.Big5 lead byte 0xeb.Big5 lead byte 0xeb.Big5 lead byte 0xeb.
Big5 lead byte 0xec.Big5 lead byte 0xec.Big5 lead byte 0xec.Big5 lead byte 0xec.
Big5 lead byte 0xed.Big5 lead byte 0xed.Big5 lead byte 0xed.Big5 lead byte 0xed.
Big5 lead byte 0xee.Big5 lead byte 0xee.Big5 lead byte 0xee.Big5 lead byte 0xee.
Big5 lead byte 0xef.Big5 lead byte 0xef.Big5 lead byte 0xef.Big5 lead byte 0xef.
Big5 lead byte 0xf0.Big5 lead byte 0xf0.Big5 lead byte 0xf0.Big5 lead byte 0xf0.
Big5 lead byte 0xf1.Big5 lead byte 0xf1.Big5 lead byte 0xf1.Big5 lead byte 0xf1.
Big5 lead byte 0xf2.Big5 lead byte 0xf2.Big5 lead byte 0xf2.Big5 lead byte 0xf2.
Big5 lead byte 0xf3.Big5 lead byte 0xf3.Big5 lead byte 0xf3.Big5 lead byte 0xf3.
Big5 lead byte 0xf4.Big5 lead byte 0xf4.Big5 lead byte 0xf4.Big5 lead byte 0xf4.
Big5 lead byte 0xf5.Big5 lead byte 0xf5.Big5 lead byte 0xf5.Big5 lead byte 0xf5.
Big5 lead byte 0xf6.Big5 lead byte 0xf6.Big5 lead byte 0xf6.Big5 lead byte 0xf6.
Big5 lead byte 0xf7.Big5 lead byte 0xf7.Big5 lead byte 0xf7.Big5 lead byte 0xf7.
Big5 lead byte 0xf8.Big5 lead byte 0xf8.Big5 lead byte 0xf8.Big5 lead byte 0xf8.
Big5 lead byte 0xf9.Big5 lead byte 0xf9.Big5 lead byte 0xf9.Big5 lead byte 0xf9.
Block IndexBlock IndexBlock IndexBlock Index
Body Output and Mode ControlBody Output and Mode ControlBody Output and Mode ControlBody Output and Mode Control
BootstrappingBootstrappingBootstrappingBootstrapping
Bootstrapping testBootstrapping testBootstrapping testBootstrapping test
Bug HistoryBug HistoryBug HistoryBug History
BugsBugsBugsBugs
Bugs (etc) for Version 1a7Bugs (etc) for Version 1a7Bugs (etc) for Version 1a7Bugs (etc) for Version 1a7
Bugs (etc) for Version 1a8Bugs (etc) for Version 1a8Bugs (etc) for Version 1a8Bugs (etc) for Version 1a8
Bugs (etc) for Version 1a9Bugs (etc) for Version 1a9Bugs (etc) for Version 1a9Bugs (etc) for Version 1a9
BuildBuildBuildBuild
Build OCPBuild OCPBuild OCPBuild OCP
BuildingBuildingBuildingBuilding
Building InterscriptBuilding InterscriptBuilding InterscriptBuilding Interscript
Bullet ListsBullet ListsBullet ListsBullet Lists
C and C++C and C++C and C++C and C++
CJK Compatibility Ideographs f900-f9ffCJK Compatibility Ideographs f900-f9ffCJK Compatibility Ideographs f900-f9ffCJK Compatibility Ideographs f900-f9ff
CJK Compatibility Ideographs fa00-faffCJK Compatibility Ideographs fa00-faffCJK Compatibility Ideographs fa00-faffCJK Compatibility Ideographs fa00-faff
CJK Unified Ideographs 4e00-4effCJK Unified Ideographs 4e00-4effCJK Unified Ideographs 4e00-4effCJK Unified Ideographs 4e00-4eff
CJK Unified Ideographs 4f00-4fffCJK Unified Ideographs 4f00-4fffCJK Unified Ideographs 4f00-4fffCJK Unified Ideographs 4f00-4fff
CJK Unified Ideographs 5000-50ffCJK Unified Ideographs 5000-50ffCJK Unified Ideographs 5000-50ffCJK Unified Ideographs 5000-50ff
CJK Unified Ideographs 5100-51ffCJK Unified Ideographs 5100-51ffCJK Unified Ideographs 5100-51ffCJK Unified Ideographs 5100-51ff
CJK Unified Ideographs 5200-52ffCJK Unified Ideographs 5200-52ffCJK Unified Ideographs 5200-52ffCJK Unified Ideographs 5200-52ff
CJK Unified Ideographs 5300-53ffCJK Unified Ideographs 5300-53ffCJK Unified Ideographs 5300-53ffCJK Unified Ideographs 5300-53ff
CJK Unified Ideographs 5400-54ffCJK Unified Ideographs 5400-54ffCJK Unified Ideographs 5400-54ffCJK Unified Ideographs 5400-54ff
CJK Unified Ideographs 5500-55ffCJK Unified Ideographs 5500-55ffCJK Unified Ideographs 5500-55ffCJK Unified Ideographs 5500-55ff
CJK Unified Ideographs 5600-56ffCJK Unified Ideographs 5600-56ffCJK Unified Ideographs 5600-56ffCJK Unified Ideographs 5600-56ff
CJK Unified Ideographs 5700-57ffCJK Unified Ideographs 5700-57ffCJK Unified Ideographs 5700-57ffCJK Unified Ideographs 5700-57ff
CJK Unified Ideographs 5800-58ffCJK Unified Ideographs 5800-58ffCJK Unified Ideographs 5800-58ffCJK Unified Ideographs 5800-58ff
CJK Unified Ideographs 5900-59ffCJK Unified Ideographs 5900-59ffCJK Unified Ideographs 5900-59ffCJK Unified Ideographs 5900-59ff
CJK Unified Ideographs 5a00-5affCJK Unified Ideographs 5a00-5affCJK Unified Ideographs 5a00-5affCJK Unified Ideographs 5a00-5aff
CJK Unified Ideographs 5b00-5bffCJK Unified Ideographs 5b00-5bffCJK Unified Ideographs 5b00-5bffCJK Unified Ideographs 5b00-5bff
CJK Unified Ideographs 5c00-5cffCJK Unified Ideographs 5c00-5cffCJK Unified Ideographs 5c00-5cffCJK Unified Ideographs 5c00-5cff
CJK Unified Ideographs 5d00-5dffCJK Unified Ideographs 5d00-5dffCJK Unified Ideographs 5d00-5dffCJK Unified Ideographs 5d00-5dff
CJK Unified Ideographs 5e00-5effCJK Unified Ideographs 5e00-5effCJK Unified Ideographs 5e00-5effCJK Unified Ideographs 5e00-5eff
CJK Unified Ideographs 5f00-5fffCJK Unified Ideographs 5f00-5fffCJK Unified Ideographs 5f00-5fffCJK Unified Ideographs 5f00-5fff
CJK Unified Ideographs 6000-60ffCJK Unified Ideographs 6000-60ffCJK Unified Ideographs 6000-60ffCJK Unified Ideographs 6000-60ff
CJK Unified Ideographs 6100-61ffCJK Unified Ideographs 6100-61ffCJK Unified Ideographs 6100-61ffCJK Unified Ideographs 6100-61ff
CJK Unified Ideographs 6200-62ffCJK Unified Ideographs 6200-62ffCJK Unified Ideographs 6200-62ffCJK Unified Ideographs 6200-62ff
CJK Unified Ideographs 6300-63ffCJK Unified Ideographs 6300-63ffCJK Unified Ideographs 6300-63ffCJK Unified Ideographs 6300-63ff
CJK Unified Ideographs 6400-64ffCJK Unified Ideographs 6400-64ffCJK Unified Ideographs 6400-64ffCJK Unified Ideographs 6400-64ff
CJK Unified Ideographs 6500-65ffCJK Unified Ideographs 6500-65ffCJK Unified Ideographs 6500-65ffCJK Unified Ideographs 6500-65ff
CJK Unified Ideographs 6600-66ffCJK Unified Ideographs 6600-66ffCJK Unified Ideographs 6600-66ffCJK Unified Ideographs 6600-66ff
CJK Unified Ideographs 6700-67ffCJK Unified Ideographs 6700-67ffCJK Unified Ideographs 6700-67ffCJK Unified Ideographs 6700-67ff
CJK Unified Ideographs 6800-68ffCJK Unified Ideographs 6800-68ffCJK Unified Ideographs 6800-68ffCJK Unified Ideographs 6800-68ff
CJK Unified Ideographs 6900-69ffCJK Unified Ideographs 6900-69ffCJK Unified Ideographs 6900-69ffCJK Unified Ideographs 6900-69ff
CJK Unified Ideographs 6a00-6affCJK Unified Ideographs 6a00-6affCJK Unified Ideographs 6a00-6affCJK Unified Ideographs 6a00-6aff
CJK Unified Ideographs 6b00-6bffCJK Unified Ideographs 6b00-6bffCJK Unified Ideographs 6b00-6bffCJK Unified Ideographs 6b00-6bff
CJK Unified Ideographs 6c00-6cffCJK Unified Ideographs 6c00-6cffCJK Unified Ideographs 6c00-6cffCJK Unified Ideographs 6c00-6cff
CJK Unified Ideographs 6d00-6dffCJK Unified Ideographs 6d00-6dffCJK Unified Ideographs 6d00-6dffCJK Unified Ideographs 6d00-6dff
CJK Unified Ideographs 6e00-6effCJK Unified Ideographs 6e00-6effCJK Unified Ideographs 6e00-6effCJK Unified Ideographs 6e00-6eff
CJK Unified Ideographs 6f00-6fffCJK Unified Ideographs 6f00-6fffCJK Unified Ideographs 6f00-6fffCJK Unified Ideographs 6f00-6fff
CJK Unified Ideographs 7000-70ffCJK Unified Ideographs 7000-70ffCJK Unified Ideographs 7000-70ffCJK Unified Ideographs 7000-70ff
CJK Unified Ideographs 7100-71ffCJK Unified Ideographs 7100-71ffCJK Unified Ideographs 7100-71ffCJK Unified Ideographs 7100-71ff
CJK Unified Ideographs 7200-72ffCJK Unified Ideographs 7200-72ffCJK Unified Ideographs 7200-72ffCJK Unified Ideographs 7200-72ff
CJK Unified Ideographs 7300-73ffCJK Unified Ideographs 7300-73ffCJK Unified Ideographs 7300-73ffCJK Unified Ideographs 7300-73ff
CJK Unified Ideographs 7400-74ffCJK Unified Ideographs 7400-74ffCJK Unified Ideographs 7400-74ffCJK Unified Ideographs 7400-74ff
CJK Unified Ideographs 7500-75ffCJK Unified Ideographs 7500-75ffCJK Unified Ideographs 7500-75ffCJK Unified Ideographs 7500-75ff
CJK Unified Ideographs 7600-76ffCJK Unified Ideographs 7600-76ffCJK Unified Ideographs 7600-76ffCJK Unified Ideographs 7600-76ff
CJK Unified Ideographs 7700-77ffCJK Unified Ideographs 7700-77ffCJK Unified Ideographs 7700-77ffCJK Unified Ideographs 7700-77ff
CJK Unified Ideographs 7800-78ffCJK Unified Ideographs 7800-78ffCJK Unified Ideographs 7800-78ffCJK Unified Ideographs 7800-78ff
CJK Unified Ideographs 7900-79ffCJK Unified Ideographs 7900-79ffCJK Unified Ideographs 7900-79ffCJK Unified Ideographs 7900-79ff
CJK Unified Ideographs 7a00-7affCJK Unified Ideographs 7a00-7affCJK Unified Ideographs 7a00-7affCJK Unified Ideographs 7a00-7aff
CJK Unified Ideographs 7b00-7bffCJK Unified Ideographs 7b00-7bffCJK Unified Ideographs 7b00-7bffCJK Unified Ideographs 7b00-7bff
CJK Unified Ideographs 7c00-7cffCJK Unified Ideographs 7c00-7cffCJK Unified Ideographs 7c00-7cffCJK Unified Ideographs 7c00-7cff
CJK Unified Ideographs 7d00-7dffCJK Unified Ideographs 7d00-7dffCJK Unified Ideographs 7d00-7dffCJK Unified Ideographs 7d00-7dff
CJK Unified Ideographs 7e00-7effCJK Unified Ideographs 7e00-7effCJK Unified Ideographs 7e00-7effCJK Unified Ideographs 7e00-7eff
CJK Unified Ideographs 7f00-7fffCJK Unified Ideographs 7f00-7fffCJK Unified Ideographs 7f00-7fffCJK Unified Ideographs 7f00-7fff
CJK Unified Ideographs 8000-80ffCJK Unified Ideographs 8000-80ffCJK Unified Ideographs 8000-80ffCJK Unified Ideographs 8000-80ff
CJK Unified Ideographs 8100-81ffCJK Unified Ideographs 8100-81ffCJK Unified Ideographs 8100-81ffCJK Unified Ideographs 8100-81ff
CJK Unified Ideographs 8200-82ffCJK Unified Ideographs 8200-82ffCJK Unified Ideographs 8200-82ffCJK Unified Ideographs 8200-82ff
CJK Unified Ideographs 8300-83ffCJK Unified Ideographs 8300-83ffCJK Unified Ideographs 8300-83ffCJK Unified Ideographs 8300-83ff
CJK Unified Ideographs 8400-84ffCJK Unified Ideographs 8400-84ffCJK Unified Ideographs 8400-84ffCJK Unified Ideographs 8400-84ff
CJK Unified Ideographs 8500-85ffCJK Unified Ideographs 8500-85ffCJK Unified Ideographs 8500-85ffCJK Unified Ideographs 8500-85ff
CJK Unified Ideographs 8600-86ffCJK Unified Ideographs 8600-86ffCJK Unified Ideographs 8600-86ffCJK Unified Ideographs 8600-86ff
CJK Unified Ideographs 8700-87ffCJK Unified Ideographs 8700-87ffCJK Unified Ideographs 8700-87ffCJK Unified Ideographs 8700-87ff
CJK Unified Ideographs 8800-88ffCJK Unified Ideographs 8800-88ffCJK Unified Ideographs 8800-88ffCJK Unified Ideographs 8800-88ff
CJK Unified Ideographs 8900-89ffCJK Unified Ideographs 8900-89ffCJK Unified Ideographs 8900-89ffCJK Unified Ideographs 8900-89ff
CJK Unified Ideographs 8a00-8affCJK Unified Ideographs 8a00-8affCJK Unified Ideographs 8a00-8affCJK Unified Ideographs 8a00-8aff
CJK Unified Ideographs 8b00-8bffCJK Unified Ideographs 8b00-8bffCJK Unified Ideographs 8b00-8bffCJK Unified Ideographs 8b00-8bff
CJK Unified Ideographs 8c00-8cffCJK Unified Ideographs 8c00-8cffCJK Unified Ideographs 8c00-8cffCJK Unified Ideographs 8c00-8cff
CJK Unified Ideographs 8d00-8dffCJK Unified Ideographs 8d00-8dffCJK Unified Ideographs 8d00-8dffCJK Unified Ideographs 8d00-8dff
CJK Unified Ideographs 8e00-8effCJK Unified Ideographs 8e00-8effCJK Unified Ideographs 8e00-8effCJK Unified Ideographs 8e00-8eff
CJK Unified Ideographs 8f00-8fffCJK Unified Ideographs 8f00-8fffCJK Unified Ideographs 8f00-8fffCJK Unified Ideographs 8f00-8fff
CJK Unified Ideographs 9000-90ffCJK Unified Ideographs 9000-90ffCJK Unified Ideographs 9000-90ffCJK Unified Ideographs 9000-90ff
CJK Unified Ideographs 9100-91ffCJK Unified Ideographs 9100-91ffCJK Unified Ideographs 9100-91ffCJK Unified Ideographs 9100-91ff
CJK Unified Ideographs 9200-92ffCJK Unified Ideographs 9200-92ffCJK Unified Ideographs 9200-92ffCJK Unified Ideographs 9200-92ff
CJK Unified Ideographs 9300-93ffCJK Unified Ideographs 9300-93ffCJK Unified Ideographs 9300-93ffCJK Unified Ideographs 9300-93ff
CJK Unified Ideographs 9400-94ffCJK Unified Ideographs 9400-94ffCJK Unified Ideographs 9400-94ffCJK Unified Ideographs 9400-94ff
CJK Unified Ideographs 9500-95ffCJK Unified Ideographs 9500-95ffCJK Unified Ideographs 9500-95ffCJK Unified Ideographs 9500-95ff
CJK Unified Ideographs 9600-96ffCJK Unified Ideographs 9600-96ffCJK Unified Ideographs 9600-96ffCJK Unified Ideographs 9600-96ff
CJK Unified Ideographs 9700-97ffCJK Unified Ideographs 9700-97ffCJK Unified Ideographs 9700-97ffCJK Unified Ideographs 9700-97ff
CJK Unified Ideographs 9800-98ffCJK Unified Ideographs 9800-98ffCJK Unified Ideographs 9800-98ffCJK Unified Ideographs 9800-98ff
CJK Unified Ideographs 9900-99ffCJK Unified Ideographs 9900-99ffCJK Unified Ideographs 9900-99ffCJK Unified Ideographs 9900-99ff
CJK Unified Ideographs 9a00-9affCJK Unified Ideographs 9a00-9affCJK Unified Ideographs 9a00-9affCJK Unified Ideographs 9a00-9aff
CJK Unified Ideographs 9b00-9bffCJK Unified Ideographs 9b00-9bffCJK Unified Ideographs 9b00-9bffCJK Unified Ideographs 9b00-9bff
CJK Unified Ideographs 9c00-9cffCJK Unified Ideographs 9c00-9cffCJK Unified Ideographs 9c00-9cffCJK Unified Ideographs 9c00-9cff
CJK Unified Ideographs 9d00-9dffCJK Unified Ideographs 9d00-9dffCJK Unified Ideographs 9d00-9dffCJK Unified Ideographs 9d00-9dff
CJK Unified Ideographs 9e00-9effCJK Unified Ideographs 9e00-9effCJK Unified Ideographs 9e00-9effCJK Unified Ideographs 9e00-9eff
CJK Unified Ideographs 9f00-9fffCJK Unified Ideographs 9f00-9fffCJK Unified Ideographs 9f00-9fffCJK Unified Ideographs 9f00-9fff
CPythonCPythonCPythonCPython
CSS1 Cascading Style SheetsCSS1 Cascading Style SheetsCSS1 Cascading Style SheetsCSS1 Cascading Style Sheets
CacheCacheCacheCache
Calculate Action TableCalculate Action TableCalculate Action TableCalculate Action Table
Calculate LALR1itemsCalculate LALR1itemsCalculate LALR1itemsCalculate LALR1items
Calculate goto tableCalculate goto tableCalculate goto tableCalculate goto table
Call testCall testCall testCall test
Callback InterfaceCallback InterfaceCallback InterfaceCallback Interface
Canonical Combining ClassesCanonical Combining ClassesCanonical Combining ClassesCanonical Combining Classes
Capture command outputCapture command outputCapture command outputCapture command output
Cascading Style SheetsCascading Style SheetsCascading Style SheetsCascading Style Sheets
Case mappingsCase mappingsCase mappingsCase mappings
Categories with simple representation modelsCategories with simple representation modelsCategories with simple representation modelsCategories with simple representation models
Category BaseCategory BaseCategory BaseCategory Base
Category ProtocolCategory ProtocolCategory ProtocolCategory Protocol
Category generated by a directed graphCategory generated by a directed graphCategory generated by a directed graphCategory generated by a directed graph
Category of functionsCategory of functionsCategory of functionsCategory of functions
Category of stringsCategory of stringsCategory of stringsCategory of strings
Category with one arrowCategory with one arrowCategory with one arrowCategory with one arrow
Change Impact AnalysisChange Impact AnalysisChange Impact AnalysisChange Impact Analysis
Character Decomposition TagsCharacter Decomposition TagsCharacter Decomposition TagsCharacter Decomposition Tags
Character TablesCharacter TablesCharacter TablesCharacter Tables
Character set encodingsCharacter set encodingsCharacter set encodingsCharacter set encodings
Cheat method 1Cheat method 1Cheat method 1Cheat method 1
Cheat method 2Cheat method 2Cheat method 2Cheat method 2
ChunkingChunkingChunkingChunking
CitationsCitationsCitationsCitations
Class Reference TableClass Reference TableClass Reference TableClass Reference Table
Class referenceClass referenceClass referenceClass reference
ClassesClasesKategorienCodici Categoria
CodeCódigoCodeCode
Code DisplaysCode DisplaysCode DisplaysCode Displays
Code File ListCode File ListCode File ListCode File List
Code File StatusCode File StatusCode File StatusCode File Status
Code FormatingCode FormatingCode FormatingCode Formating
Code Introduction and EpilogCode Introduction and EpilogCode Introduction and EpilogCode Introduction and Epilog
Code OutputCode OutputCode OutputCode Output
Code and Prose displaysCode and Prose displaysCode and Prose displaysCode and Prose displays
Code displaysCode displaysCode displaysCode displays
Code echoCode echoCode echoCode echo
Code generatorCode generatorCode generatorCode generator
Code sectionsCode sectionsCode sectionsCode sections
Collect stuffCollect stuffCollect stuffCollect stuff
Command line tool executionCommand line tool executionCommand line tool executionCommand line tool execution
CommandsCommandsCommandsCommands
CompilersCompilersCompilersCompilers
Compilers sub-packageCompilers sub-packageCompilers sub-packageCompilers sub-package
Complex Disk File SinkComplex Disk File SinkComplex Disk File SinkComplex Disk File Sink
Composable FunctionComposable FunctionComposable FunctionComposable Function
ConfigurationConfigurationConfigurationConfiguration
Configuring your browser for UTF-8Configuring your browser for UTF-8Configuring your browser for UTF-8Configuring your browser for UTF-8
Configuring your browser for XMLConfiguring your browser for XMLConfiguring your browser for XMLConfiguring your browser for XML
Configuring your editorConfiguring your editorConfiguring your editorConfiguring your editor
Constant FunctionConstant FunctionConstant FunctionConstant Function
Construct Global FrameConstruct Global FrameConstruct Global FrameConstruct Global Frame
Construct input objectConstruct input objectConstruct input objectConstruct input object
ConstructionsConstructionsConstructionsConstructions
ConstructorConstructorConstructorConstructor
ContentsContenidosContentsContents
Control SystemControl SystemControl SystemControl System
Convenience commandsConvenience commandsConvenience commandsConvenience commands
Convergence statusConvergence statusConvergence statusConvergence status
Conversion functionsConversion functionsConversion functionsConversion functions
Core SubpackageCore SubpackageCore SubpackageCore Subpackage
CreditsCreditsCreditsCredits
Cross ReferencesCross ReferencesCross ReferencesCross References
Cross referencesCross referencesCross referencesCross references
Cumulated AppendicesCumulated AppendicesCumulated AppendicesCumulated Appendices
Data TanglerData TanglerData TanglerData Tangler
Data structureData structureData structureData structure
DependenciesDependenciesDependenciesDependencies
Dependency checkingDependency checkingDependency checkingDependency checking
DescriptionDescriptionDescriptionDescription
Design DocumentDesign DocumentDesign DocumentDesign Document
Design FundamentalsDesign FundamentalsDesign FundamentalsDesign Fundamentals
Design IssuesDesign IssuesDesign IssuesDesign Issues
Detailed Character PropertiesDetailed Character PropertiesDetailed Character PropertiesDetailed Character Properties
Detailed Property DataDetailed Property DataDetailed Property DataDetailed Property Data
DevicesDevicesDevicesDevices
Diff sub-packageDiff sub-packageDiff sub-packageDiff sub-package
Diff/PatchDiff/PatchDiff/PatchDiff/Patch
Discriminated unionDiscriminated unionDiscriminated unionDiscriminated union
Disk DriverDisk DriverDisk DriverDisk Driver
Disk File InputDisk File InputDisk File InputDisk File Input
Displaying CodeDisplaying CodeDisplaying CodeDisplaying Code
Displaying code examplesDisplaying code examplesDisplaying code examplesDisplaying code examples
DisplaysDisplaysDisplaysDisplays
Displays, Line and Page BreaksDisplays, Line and Page BreaksDisplays, Line and Page BreaksDisplays, Line and Page Breaks
Document TanglerDocument TanglerDocument TanglerDocument Tangler
Document generatorDocument generatorDocument generatorDocument generator
Documentation ConstructionsDocumentation ConstructionsDocumentation ConstructionsDocumentation Constructions
Doubled Warning characterDoubled Warning characterDoubled Warning characterDoubled Warning character
Drivers SubpackageDrivers SubpackageDrivers SubpackageDrivers Subpackage
DualDualDualDual
Easier listsEasier listsEasier listsEasier lists
Ebcdic_Cp037Ebcdic_Cp037Ebcdic_Cp037Ebcdic_Cp037
Ebcdic_Cp1026Ebcdic_Cp1026Ebcdic_Cp1026Ebcdic_Cp1026
Ebcdic_Cp500Ebcdic_Cp500Ebcdic_Cp500Ebcdic_Cp500
Ebcdic_Cp875Ebcdic_Cp875Ebcdic_Cp875Ebcdic_Cp875
EiffelEiffelEiffelEiffel
Empty CategoryEmpty CategoryEmpty CategoryEmpty Category
EncodingEncodingEncodingEncoding
EndFinEndeestremità
End ExceptionsEnd ExceptionsEnd ExceptionsEnd Exceptions
End of Python--Lout DefinitionsEnd of Python--Lout DefinitionsEnd of Python--Lout DefinitionsEnd of Python--Lout Definitions
Execute Python ScriptExecute Python ScriptExecute Python ScriptExecute Python Script
Execute collected pythonExecute collected pythonExecute collected pythonExecute collected python
Executing external toolsExecuting external toolsExecuting external toolsExecuting external tools
Extensive Python SupportExtensive Python SupportExtensive Python SupportExtensive Python Support
FTP inputFTP inputFTP inputFTP input
FeaturesFeaturesFeaturesFeatures
Felix Object protocolFelix Object protocolFelix Object protocolFelix Object protocol
Felix PackageFelix PackageFelix PackageFelix Package
File NamesFile NamesFile NamesFile Names
File listFile listFile listFile list
File namesFile namesFile namesFile names
Find FIRST setsFind FIRST setsFind FIRST setsFind FIRST sets
Find FOLLOW setsFind FOLLOW setsFind FOLLOW setsFind FOLLOW sets
Find Nullable NonTerminalsFind Nullable NonTerminalsFind Nullable NonTerminalsFind Nullable NonTerminals
Finite Category modelFinite Category modelFinite Category modelFinite Category model
FirstPrimeroErstePrimo
First SubheadingFirst SubheadingFirst SubheadingFirst Subheading
First SubsubheadingFirst SubsubheadingFirst SubsubheadingFirst Subsubheading
Fixed bugsFixed bugsFixed bugsFixed bugs
Flexible navigationFlexible navigationFlexible navigationFlexible navigation
Folding Table of ContentsFolding Table of ContentsFolding Table of ContentsFolding Table of Contents
Font ChangesFont ChangesFont ChangesFont Changes
FontsFontsFontsFonts
Frame presentationFrame presentationFrame presentationFrame presentation
Full source listingFull source listingFull source listingFull source listing
Fully Parsable LanguagesFully Parsable LanguagesFully Parsable LanguagesFully Parsable Languages
Function ProductFunction ProductFunction ProductFunction Product
Function SumFunction SumFunction SumFunction Sum
Function categoryFunction categoryFunction categoryFunction category
Function generatorFunction generatorFunction generatorFunction generator
Function referenceFunction referenceFunction referenceFunction reference
FunctionalityFunctionalityFunctionalityFunctionality
FunctionsFuncionesFunktionenFunctions
GB 2312 MappingGB 2312 MappingGB 2312 MappingGB 2312 Mapping
GB2312 lead byte 0xa1.GB2312 lead byte 0xa1.GB2312 lead byte 0xa1.GB2312 lead byte 0xa1.
GB2312 lead byte 0xa2.GB2312 lead byte 0xa2.GB2312 lead byte 0xa2.GB2312 lead byte 0xa2.
GB2312 lead byte 0xa3.GB2312 lead byte 0xa3.GB2312 lead byte 0xa3.GB2312 lead byte 0xa3.
GB2312 lead byte 0xa4.GB2312 lead byte 0xa4.GB2312 lead byte 0xa4.GB2312 lead byte 0xa4.
GB2312 lead byte 0xa5.GB2312 lead byte 0xa5.GB2312 lead byte 0xa5.GB2312 lead byte 0xa5.
GB2312 lead byte 0xa6.GB2312 lead byte 0xa6.GB2312 lead byte 0xa6.GB2312 lead byte 0xa6.
GB2312 lead byte 0xa7.GB2312 lead byte 0xa7.GB2312 lead byte 0xa7.GB2312 lead byte 0xa7.
GB2312 lead byte 0xa8.GB2312 lead byte 0xa8.GB2312 lead byte 0xa8.GB2312 lead byte 0xa8.
GB2312 lead byte 0xa9.GB2312 lead byte 0xa9.GB2312 lead byte 0xa9.GB2312 lead byte 0xa9.
GB2312 lead byte 0xaa.GB2312 lead byte 0xaa.GB2312 lead byte 0xaa.GB2312 lead byte 0xaa.
GB2312 lead byte 0xab.GB2312 lead byte 0xab.GB2312 lead byte 0xab.GB2312 lead byte 0xab.
GB2312 lead byte 0xac.GB2312 lead byte 0xac.GB2312 lead byte 0xac.GB2312 lead byte 0xac.
GB2312 lead byte 0xad.GB2312 lead byte 0xad.GB2312 lead byte 0xad.GB2312 lead byte 0xad.
GB2312 lead byte 0xae.GB2312 lead byte 0xae.GB2312 lead byte 0xae.GB2312 lead byte 0xae.
GB2312 lead byte 0xaf.GB2312 lead byte 0xaf.GB2312 lead byte 0xaf.GB2312 lead byte 0xaf.
GB2312 lead byte 0xb0.GB2312 lead byte 0xb0.GB2312 lead byte 0xb0.GB2312 lead byte 0xb0.
GB2312 lead byte 0xb1.GB2312 lead byte 0xb1.GB2312 lead byte 0xb1.GB2312 lead byte 0xb1.
GB2312 lead byte 0xb2.GB2312 lead byte 0xb2.GB2312 lead byte 0xb2.GB2312 lead byte 0xb2.
GB2312 lead byte 0xb3.GB2312 lead byte 0xb3.GB2312 lead byte 0xb3.GB2312 lead byte 0xb3.
GB2312 lead byte 0xb4.GB2312 lead byte 0xb4.GB2312 lead byte 0xb4.GB2312 lead byte 0xb4.
GB2312 lead byte 0xb5.GB2312 lead byte 0xb5.GB2312 lead byte 0xb5.GB2312 lead byte 0xb5.
GB2312 lead byte 0xb6.GB2312 lead byte 0xb6.GB2312 lead byte 0xb6.GB2312 lead byte 0xb6.
GB2312 lead byte 0xb7.GB2312 lead byte 0xb7.GB2312 lead byte 0xb7.GB2312 lead byte 0xb7.
GB2312 lead byte 0xb8.GB2312 lead byte 0xb8.GB2312 lead byte 0xb8.GB2312 lead byte 0xb8.
GB2312 lead byte 0xb9.GB2312 lead byte 0xb9.GB2312 lead byte 0xb9.GB2312 lead byte 0xb9.
GB2312 lead byte 0xba.GB2312 lead byte 0xba.GB2312 lead byte 0xba.GB2312 lead byte 0xba.
GB2312 lead byte 0xbb.GB2312 lead byte 0xbb.GB2312 lead byte 0xbb.GB2312 lead byte 0xbb.
GB2312 lead byte 0xbc.GB2312 lead byte 0xbc.GB2312 lead byte 0xbc.GB2312 lead byte 0xbc.
GB2312 lead byte 0xbd.GB2312 lead byte 0xbd.GB2312 lead byte 0xbd.GB2312 lead byte 0xbd.
GB2312 lead byte 0xbe.GB2312 lead byte 0xbe.GB2312 lead byte 0xbe.GB2312 lead byte 0xbe.
GB2312 lead byte 0xbf.GB2312 lead byte 0xbf.GB2312 lead byte 0xbf.GB2312 lead byte 0xbf.
GB2312 lead byte 0xc0.GB2312 lead byte 0xc0.GB2312 lead byte 0xc0.GB2312 lead byte 0xc0.
GB2312 lead byte 0xc1.GB2312 lead byte 0xc1.GB2312 lead byte 0xc1.GB2312 lead byte 0xc1.
GB2312 lead byte 0xc2.GB2312 lead byte 0xc2.GB2312 lead byte 0xc2.GB2312 lead byte 0xc2.
GB2312 lead byte 0xc3.GB2312 lead byte 0xc3.GB2312 lead byte 0xc3.GB2312 lead byte 0xc3.
GB2312 lead byte 0xc4.GB2312 lead byte 0xc4.GB2312 lead byte 0xc4.GB2312 lead byte 0xc4.
GB2312 lead byte 0xc5.GB2312 lead byte 0xc5.GB2312 lead byte 0xc5.GB2312 lead byte 0xc5.
GB2312 lead byte 0xc6.GB2312 lead byte 0xc6.GB2312 lead byte 0xc6.GB2312 lead byte 0xc6.
GB2312 lead byte 0xc7.GB2312 lead byte 0xc7.GB2312 lead byte 0xc7.GB2312 lead byte 0xc7.
GB2312 lead byte 0xc8.GB2312 lead byte 0xc8.GB2312 lead byte 0xc8.GB2312 lead byte 0xc8.
GB2312 lead byte 0xc9.GB2312 lead byte 0xc9.GB2312 lead byte 0xc9.GB2312 lead byte 0xc9.
GB2312 lead byte 0xca.GB2312 lead byte 0xca.GB2312 lead byte 0xca.GB2312 lead byte 0xca.
GB2312 lead byte 0xcb.GB2312 lead byte 0xcb.GB2312 lead byte 0xcb.GB2312 lead byte 0xcb.
GB2312 lead byte 0xcc.GB2312 lead byte 0xcc.GB2312 lead byte 0xcc.GB2312 lead byte 0xcc.
GB2312 lead byte 0xcd.GB2312 lead byte 0xcd.GB2312 lead byte 0xcd.GB2312 lead byte 0xcd.
GB2312 lead byte 0xce.GB2312 lead byte 0xce.GB2312 lead byte 0xce.GB2312 lead byte 0xce.
GB2312 lead byte 0xcf.GB2312 lead byte 0xcf.GB2312 lead byte 0xcf.GB2312 lead byte 0xcf.
GB2312 lead byte 0xd0.GB2312 lead byte 0xd0.GB2312 lead byte 0xd0.GB2312 lead byte 0xd0.
GB2312 lead byte 0xd1.GB2312 lead byte 0xd1.GB2312 lead byte 0xd1.GB2312 lead byte 0xd1.
GB2312 lead byte 0xd2.GB2312 lead byte 0xd2.GB2312 lead byte 0xd2.GB2312 lead byte 0xd2.
GB2312 lead byte 0xd3.GB2312 lead byte 0xd3.GB2312 lead byte 0xd3.GB2312 lead byte 0xd3.
GB2312 lead byte 0xd4.GB2312 lead byte 0xd4.GB2312 lead byte 0xd4.GB2312 lead byte 0xd4.
GB2312 lead byte 0xd5.GB2312 lead byte 0xd5.GB2312 lead byte 0xd5.GB2312 lead byte 0xd5.
GB2312 lead byte 0xd6.GB2312 lead byte 0xd6.GB2312 lead byte 0xd6.GB2312 lead byte 0xd6.
GB2312 lead byte 0xd7.GB2312 lead byte 0xd7.GB2312 lead byte 0xd7.GB2312 lead byte 0xd7.
GB2312 lead byte 0xd8.GB2312 lead byte 0xd8.GB2312 lead byte 0xd8.GB2312 lead byte 0xd8.
GB2312 lead byte 0xd9.GB2312 lead byte 0xd9.GB2312 lead byte 0xd9.GB2312 lead byte 0xd9.
GB2312 lead byte 0xda.GB2312 lead byte 0xda.GB2312 lead byte 0xda.GB2312 lead byte 0xda.
GB2312 lead byte 0xdb.GB2312 lead byte 0xdb.GB2312 lead byte 0xdb.GB2312 lead byte 0xdb.
GB2312 lead byte 0xdc.GB2312 lead byte 0xdc.GB2312 lead byte 0xdc.GB2312 lead byte 0xdc.
GB2312 lead byte 0xdd.GB2312 lead byte 0xdd.GB2312 lead byte 0xdd.GB2312 lead byte 0xdd.
GB2312 lead byte 0xde.GB2312 lead byte 0xde.GB2312 lead byte 0xde.GB2312 lead byte 0xde.
GB2312 lead byte 0xdf.GB2312 lead byte 0xdf.GB2312 lead byte 0xdf.GB2312 lead byte 0xdf.
GB2312 lead byte 0xe0.GB2312 lead byte 0xe0.GB2312 lead byte 0xe0.GB2312 lead byte 0xe0.
GB2312 lead byte 0xe1.GB2312 lead byte 0xe1.GB2312 lead byte 0xe1.GB2312 lead byte 0xe1.
GB2312 lead byte 0xe2.GB2312 lead byte 0xe2.GB2312 lead byte 0xe2.GB2312 lead byte 0xe2.
GB2312 lead byte 0xe3.GB2312 lead byte 0xe3.GB2312 lead byte 0xe3.GB2312 lead byte 0xe3.
GB2312 lead byte 0xe4.GB2312 lead byte 0xe4.GB2312 lead byte 0xe4.GB2312 lead byte 0xe4.
GB2312 lead byte 0xe5.GB2312 lead byte 0xe5.GB2312 lead byte 0xe5.GB2312 lead byte 0xe5.
GB2312 lead byte 0xe6.GB2312 lead byte 0xe6.GB2312 lead byte 0xe6.GB2312 lead byte 0xe6.
GB2312 lead byte 0xe7.GB2312 lead byte 0xe7.GB2312 lead byte 0xe7.GB2312 lead byte 0xe7.
GB2312 lead byte 0xe8.GB2312 lead byte 0xe8.GB2312 lead byte 0xe8.GB2312 lead byte 0xe8.
GB2312 lead byte 0xe9.GB2312 lead byte 0xe9.GB2312 lead byte 0xe9.GB2312 lead byte 0xe9.
GB2312 lead byte 0xea.GB2312 lead byte 0xea.GB2312 lead byte 0xea.GB2312 lead byte 0xea.
GB2312 lead byte 0xeb.GB2312 lead byte 0xeb.GB2312 lead byte 0xeb.GB2312 lead byte 0xeb.
GB2312 lead byte 0xec.GB2312 lead byte 0xec.GB2312 lead byte 0xec.GB2312 lead byte 0xec.
GB2312 lead byte 0xed.GB2312 lead byte 0xed.GB2312 lead byte 0xed.GB2312 lead byte 0xed.
GB2312 lead byte 0xee.GB2312 lead byte 0xee.GB2312 lead byte 0xee.GB2312 lead byte 0xee.
GB2312 lead byte 0xef.GB2312 lead byte 0xef.GB2312 lead byte 0xef.GB2312 lead byte 0xef.
GB2312 lead byte 0xf0.GB2312 lead byte 0xf0.GB2312 lead byte 0xf0.GB2312 lead byte 0xf0.
GB2312 lead byte 0xf1.GB2312 lead byte 0xf1.GB2312 lead byte 0xf1.GB2312 lead byte 0xf1.
GB2312 lead byte 0xf2.GB2312 lead byte 0xf2.GB2312 lead byte 0xf2.GB2312 lead byte 0xf2.
GB2312 lead byte 0xf3.GB2312 lead byte 0xf3.GB2312 lead byte 0xf3.GB2312 lead byte 0xf3.
GB2312 lead byte 0xf4.GB2312 lead byte 0xf4.GB2312 lead byte 0xf4.GB2312 lead byte 0xf4.
GB2312 lead byte 0xf5.GB2312 lead byte 0xf5.GB2312 lead byte 0xf5.GB2312 lead byte 0xf5.
GB2312 lead byte 0xf6.GB2312 lead byte 0xf6.GB2312 lead byte 0xf6.GB2312 lead byte 0xf6.
GB2312 lead byte 0xf7.GB2312 lead byte 0xf7.GB2312 lead byte 0xf7.GB2312 lead byte 0xf7.
GB2312 lead byte 0xf8.GB2312 lead byte 0xf8.GB2312 lead byte 0xf8.GB2312 lead byte 0xf8.
GB2312 lead byte 0xf9.GB2312 lead byte 0xf9.GB2312 lead byte 0xf9.GB2312 lead byte 0xf9.
GB2312 lead byte 0xfa.GB2312 lead byte 0xfa.GB2312 lead byte 0xfa.GB2312 lead byte 0xfa.
GB2312 lead byte 0xfb.GB2312 lead byte 0xfb.GB2312 lead byte 0xfb.GB2312 lead byte 0xfb.
GB2312 lead byte 0xfc.GB2312 lead byte 0xfc.GB2312 lead byte 0xfc.GB2312 lead byte 0xfc.
GB2312 lead byte 0xfd.GB2312 lead byte 0xfd.GB2312 lead byte 0xfd.GB2312 lead byte 0xfd.
GB2312 lead byte 0xfe.GB2312 lead byte 0xfe.GB2312 lead byte 0xfe.GB2312 lead byte 0xfe.
General CategoryGeneral CategoryGeneral CategoryGeneral Category
Get OptionsGet OptionsGet OptionsGet Options
Getting GNU toolsGetting GNU toolsGetting GNU toolsGetting GNU tools
Getting JavaGetting JavaGetting JavaGetting Java
Getting OmegaGetting OmegaGetting OmegaGetting Omega
Getting PythonGetting PythonGetting PythonGetting Python
GrammarGrammarGrammarGrammar
Grammar ProductionsGrammar ProductionsGrammar ProductionsGrammar Productions
GroupsGroupsGroupsGroups
HTML HeaderHTML HeaderHTML HeaderHTML Header
HTML ParserHTML ParserHTML ParserHTML Parser
HTML WeaverHTML WeaverHTML WeaverHTML Weaver
HTTP inputHTTP inputHTTP inputHTTP input
Hangul Syllables ac00-acffHangul Syllables ac00-acffHangul Syllables ac00-acffHangul Syllables ac00-acff
Hangul Syllables ad00-adffHangul Syllables ad00-adffHangul Syllables ad00-adffHangul Syllables ad00-adff
Hangul Syllables ae00-aeffHangul Syllables ae00-aeffHangul Syllables ae00-aeffHangul Syllables ae00-aeff
Hangul Syllables af00-afffHangul Syllables af00-afffHangul Syllables af00-afffHangul Syllables af00-afff
Hangul Syllables b000-b0ffHangul Syllables b000-b0ffHangul Syllables b000-b0ffHangul Syllables b000-b0ff
Hangul Syllables b100-b1ffHangul Syllables b100-b1ffHangul Syllables b100-b1ffHangul Syllables b100-b1ff
Hangul Syllables b200-b2ffHangul Syllables b200-b2ffHangul Syllables b200-b2ffHangul Syllables b200-b2ff
Hangul Syllables b300-b3ffHangul Syllables b300-b3ffHangul Syllables b300-b3ffHangul Syllables b300-b3ff
Hangul Syllables b400-b4ffHangul Syllables b400-b4ffHangul Syllables b400-b4ffHangul Syllables b400-b4ff
Hangul Syllables b500-b5ffHangul Syllables b500-b5ffHangul Syllables b500-b5ffHangul Syllables b500-b5ff
Hangul Syllables b600-b6ffHangul Syllables b600-b6ffHangul Syllables b600-b6ffHangul Syllables b600-b6ff
Hangul Syllables b700-b7ffHangul Syllables b700-b7ffHangul Syllables b700-b7ffHangul Syllables b700-b7ff
Hangul Syllables b800-b8ffHangul Syllables b800-b8ffHangul Syllables b800-b8ffHangul Syllables b800-b8ff
Hangul Syllables b900-b9ffHangul Syllables b900-b9ffHangul Syllables b900-b9ffHangul Syllables b900-b9ff
Hangul Syllables ba00-baffHangul Syllables ba00-baffHangul Syllables ba00-baffHangul Syllables ba00-baff
Hangul Syllables bb00-bbffHangul Syllables bb00-bbffHangul Syllables bb00-bbffHangul Syllables bb00-bbff
Hangul Syllables bc00-bcffHangul Syllables bc00-bcffHangul Syllables bc00-bcffHangul Syllables bc00-bcff
Hangul Syllables bd00-bdffHangul Syllables bd00-bdffHangul Syllables bd00-bdffHangul Syllables bd00-bdff
Hangul Syllables be00-beffHangul Syllables be00-beffHangul Syllables be00-beffHangul Syllables be00-beff
Hangul Syllables bf00-bfffHangul Syllables bf00-bfffHangul Syllables bf00-bfffHangul Syllables bf00-bfff
Hangul Syllables c000-c0ffHangul Syllables c000-c0ffHangul Syllables c000-c0ffHangul Syllables c000-c0ff
Hangul Syllables c100-c1ffHangul Syllables c100-c1ffHangul Syllables c100-c1ffHangul Syllables c100-c1ff
Hangul Syllables c200-c2ffHangul Syllables c200-c2ffHangul Syllables c200-c2ffHangul Syllables c200-c2ff
Hangul Syllables c300-c3ffHangul Syllables c300-c3ffHangul Syllables c300-c3ffHangul Syllables c300-c3ff
Hangul Syllables c400-c4ffHangul Syllables c400-c4ffHangul Syllables c400-c4ffHangul Syllables c400-c4ff
Hangul Syllables c500-c5ffHangul Syllables c500-c5ffHangul Syllables c500-c5ffHangul Syllables c500-c5ff
Hangul Syllables c600-c6ffHangul Syllables c600-c6ffHangul Syllables c600-c6ffHangul Syllables c600-c6ff
Hangul Syllables c700-c7ffHangul Syllables c700-c7ffHangul Syllables c700-c7ffHangul Syllables c700-c7ff
Hangul Syllables c800-c8ffHangul Syllables c800-c8ffHangul Syllables c800-c8ffHangul Syllables c800-c8ff
Hangul Syllables c900-c9ffHangul Syllables c900-c9ffHangul Syllables c900-c9ffHangul Syllables c900-c9ff
Hangul Syllables ca00-caffHangul Syllables ca00-caffHangul Syllables ca00-caffHangul Syllables ca00-caff
Hangul Syllables cb00-cbffHangul Syllables cb00-cbffHangul Syllables cb00-cbffHangul Syllables cb00-cbff
Hangul Syllables cc00-ccffHangul Syllables cc00-ccffHangul Syllables cc00-ccffHangul Syllables cc00-ccff
Hangul Syllables cd00-cdffHangul Syllables cd00-cdffHangul Syllables cd00-cdffHangul Syllables cd00-cdff
Hangul Syllables ce00-ceffHangul Syllables ce00-ceffHangul Syllables ce00-ceffHangul Syllables ce00-ceff
Hangul Syllables cf00-cfffHangul Syllables cf00-cfffHangul Syllables cf00-cfffHangul Syllables cf00-cfff
Hangul Syllables d000-d0ffHangul Syllables d000-d0ffHangul Syllables d000-d0ffHangul Syllables d000-d0ff
Hangul Syllables d100-d1ffHangul Syllables d100-d1ffHangul Syllables d100-d1ffHangul Syllables d100-d1ff
Hangul Syllables d200-d2ffHangul Syllables d200-d2ffHangul Syllables d200-d2ffHangul Syllables d200-d2ff
Hangul Syllables d300-d3ffHangul Syllables d300-d3ffHangul Syllables d300-d3ffHangul Syllables d300-d3ff
Hangul Syllables d400-d4ffHangul Syllables d400-d4ffHangul Syllables d400-d4ffHangul Syllables d400-d4ff
Hangul Syllables d500-d5ffHangul Syllables d500-d5ffHangul Syllables d500-d5ffHangul Syllables d500-d5ff
Hangul Syllables d600-d6ffHangul Syllables d600-d6ffHangul Syllables d600-d6ffHangul Syllables d600-d6ff
Hangul Syllables d700-d7a3Hangul Syllables d700-d7a3Hangul Syllables d700-d7a3Hangul Syllables d700-d7a3
Hash TanglerHash TanglerHash TanglerHash Tangler
Heading Helper closeLevelsHeading Helper closeLevelsHeading Helper closeLevelsHeading Helper closeLevels
Heading Helper openLevelsHeading Helper openLevelsHeading Helper openLevelsHeading Helper openLevels
HeadingsHeadingsHeadingsHeadings
Hello World from John SkallerHello World from John SkallerHello World from John SkallerHello World from John Skaller
Help DictionaryHelp DictionaryHelp DictionaryHelp Dictionary
High Surrogates d800-d8ffHigh Surrogates d800-d8ffHigh Surrogates d800-d8ffHigh Surrogates d800-d8ff
High Surrogates d900-d9ffHigh Surrogates d900-d9ffHigh Surrogates d900-d9ffHigh Surrogates d900-d9ff
High Surrogates da00-daffHigh Surrogates da00-daffHigh Surrogates da00-daffHigh Surrogates da00-daff
High Surrogates db00-db7fHigh Surrogates db00-db7fHigh Surrogates db00-db7fHigh Surrogates db00-db7f
How can I use existing HTML as a source?How can I use existing HTML as a source?How can I use existing HTML as a source?How can I use existing HTML as a source?
How do I debug InterscriptHow do I debug InterscriptHow do I debug InterscriptHow do I debug Interscript
How do I get existing code into Interscript?How do I get existing code into Interscript?How do I get existing code into Interscript?How do I get existing code into Interscript?
Html inputHtml inputHtml inputHtml input
Html input filterHtml input filterHtml input filterHtml input filter
ISO-10646 encodingsISO-10646 encodingsISO-10646 encodingsISO-10646 encodings
Identifier Cross Reference TableIdentifier Cross Reference TableIdentifier Cross Reference TableIdentifier Cross Reference Table
Identifier Cross referencesIdentifier Cross referencesIdentifier Cross referencesIdentifier Cross references
Identifier IndexIdentifier IndexIdentifier IndexIdentifier Index
Identifier referenceIdentifier referenceIdentifier referenceIdentifier reference
IdentifiersIdentificadoresIdentifiersIdentifiers
IdentityIdentityIdentityIdentity
ImplementationImplementationImplementationImplementation
Implementation pragmaticsImplementation pragmaticsImplementation pragmaticsImplementation pragmatics
Include ListInclude ListInclude ListInclude List
Include file/sourceInclude file/sourceInclude file/sourceInclude file/source
Include htmlInclude htmlInclude htmlInclude html
Include/insert codeInclude/insert codeInclude/insert codeInclude/insert code
Including FilesIncluding FilesIncluding FilesIncluding Files
Including codeIncluding codeIncluding codeIncluding code
Individual WeaversIndividual WeaversIndividual WeaversIndividual Weavers
Individual encodingsIndividual encodingsIndividual encodingsIndividual encodings
Individual weaver capabilitiesIndividual weaver capabilitiesIndividual weaver capabilitiesIndividual weaver capabilities
InitialisationInitialisationInitialisationInitialisation
Input AdapterInput AdapterInput AdapterInput Adapter
Input File ListInput File ListInput File ListInput File List
Input FrameInput FrameInput FrameInput Frame
Input functionsInput functionsInput functionsInput functions
Install FrameInstall FrameInstall FrameInstall Frame
Install docoInstall docoInstall docoInstall doco
InstallationInstalaciónInstallationInstallation
Installation GuideInstallation GuideInstallation GuideInstallation Guide
Instant installInstant installInstant installInstant install
Integer AdditionInteger AdditionInteger AdditionInteger Addition
Integer MultiplicationInteger MultiplicationInteger MultiplicationInteger Multiplication
InterfaceInterfaceInterfaceInterface
InternationalisationInternationalisationInternationalisationInternationalisation
Internet Explorer DHTML supportInternet Explorer DHTML supportInternet Explorer DHTML supportInternet Explorer DHTML support
InterscriptInterscriptInterscriptInterscript
Interscript ModuleInterscript ModuleInterscript ModuleInterscript Module
Interscript Standard module diff for PythonInterscript Standard module diff for PythonInterscript Standard module diff for PythonInterscript Standard module diff for Python
Interscript Style SheetInterscript Style SheetInterscript Style SheetInterscript Style Sheet
Interscript VersionInterscript VersionInterscript VersionInterscript Version
IntroductionIntroductionIntroductionIntroduction
Introduction to categoriesIntroduction to categoriesIntroduction to categoriesIntroduction to categories
Invoke interscriptInvoke interscriptInvoke interscriptInvoke interscript
Isn't it hard to create an HTML filter?Isn't it hard to create an HTML filter?Isn't it hard to create an HTML filter?Isn't it hard to create an HTML filter?
Iso 8859-x MappingsIso 8859-x MappingsIso 8859-x MappingsIso 8859-x Mappings
Iso8859-1Iso8859-1Iso8859-1Iso8859-1
Iso8859-14Iso8859-14Iso8859-14Iso8859-14
Iso8859-15Iso8859-15Iso8859-15Iso8859-15
Iso8859-2Iso8859-2Iso8859-2Iso8859-2
Iso8859-3Iso8859-3Iso8859-3Iso8859-3
Iso8859-4Iso8859-4Iso8859-4Iso8859-4
Iso8859-5Iso8859-5Iso8859-5Iso8859-5
Iso8859-6Iso8859-6Iso8859-6Iso8859-6
Iso8859-7Iso8859-7Iso8859-7Iso8859-7
Iso8859-8Iso8859-8Iso8859-8Iso8859-8
Iso8859-9Iso8859-9Iso8859-9Iso8859-9
JPythonJPythonJPythonJPython
Java DOCJava DOCJava DOCJava DOC
Java TanglerJava TanglerJava TanglerJava Tangler
KSC-5601-1987 (Wansung) MappingKSC-5601-1987 (Wansung) MappingKSC-5601-1987 (Wansung) MappingKSC-5601-1987 (Wansung) Mapping
KSC-5601-1992 (Johab) MappingKSC-5601-1992 (Johab) MappingKSC-5601-1992 (Johab) MappingKSC-5601-1992 (Johab) Mapping
KSC5601-1987 (Wansung) lead byte 0x21.KSC5601-1987 (Wansung) lead byte 0x21.KSC5601-1987 (Wansung) lead byte 0x21.KSC5601-1987 (Wansung) lead byte 0x21.
KSC5601-1987 (Wansung) lead byte 0x22.KSC5601-1987 (Wansung) lead byte 0x22.KSC5601-1987 (Wansung) lead byte 0x22.KSC5601-1987 (Wansung) lead byte 0x22.
KSC5601-1987 (Wansung) lead byte 0x23.KSC5601-1987 (Wansung) lead byte 0x23.KSC5601-1987 (Wansung) lead byte 0x23.KSC5601-1987 (Wansung) lead byte 0x23.
KSC5601-1987 (Wansung) lead byte 0x24.KSC5601-1987 (Wansung) lead byte 0x24.KSC5601-1987 (Wansung) lead byte 0x24.KSC5601-1987 (Wansung) lead byte 0x24.
KSC5601-1987 (Wansung) lead byte 0x25.KSC5601-1987 (Wansung) lead byte 0x25.KSC5601-1987 (Wansung) lead byte 0x25.KSC5601-1987 (Wansung) lead byte 0x25.
KSC5601-1987 (Wansung) lead byte 0x26.KSC5601-1987 (Wansung) lead byte 0x26.KSC5601-1987 (Wansung) lead byte 0x26.KSC5601-1987 (Wansung) lead byte 0x26.
KSC5601-1987 (Wansung) lead byte 0x27.KSC5601-1987 (Wansung) lead byte 0x27.KSC5601-1987 (Wansung) lead byte 0x27.KSC5601-1987 (Wansung) lead byte 0x27.
KSC5601-1987 (Wansung) lead byte 0x28.KSC5601-1987 (Wansung) lead byte 0x28.KSC5601-1987 (Wansung) lead byte 0x28.KSC5601-1987 (Wansung) lead byte 0x28.
KSC5601-1987 (Wansung) lead byte 0x29.KSC5601-1987 (Wansung) lead byte 0x29.KSC5601-1987 (Wansung) lead byte 0x29.KSC5601-1987 (Wansung) lead byte 0x29.
KSC5601-1987 (Wansung) lead byte 0x2a.KSC5601-1987 (Wansung) lead byte 0x2a.KSC5601-1987 (Wansung) lead byte 0x2a.KSC5601-1987 (Wansung) lead byte 0x2a.
KSC5601-1987 (Wansung) lead byte 0x2b.KSC5601-1987 (Wansung) lead byte 0x2b.KSC5601-1987 (Wansung) lead byte 0x2b.KSC5601-1987 (Wansung) lead byte 0x2b.
KSC5601-1987 (Wansung) lead byte 0x2c.KSC5601-1987 (Wansung) lead byte 0x2c.KSC5601-1987 (Wansung) lead byte 0x2c.KSC5601-1987 (Wansung) lead byte 0x2c.
KSC5601-1987 (Wansung) lead byte 0x2d.KSC5601-1987 (Wansung) lead byte 0x2d.KSC5601-1987 (Wansung) lead byte 0x2d.KSC5601-1987 (Wansung) lead byte 0x2d.
KSC5601-1987 (Wansung) lead byte 0x2e.KSC5601-1987 (Wansung) lead byte 0x2e.KSC5601-1987 (Wansung) lead byte 0x2e.KSC5601-1987 (Wansung) lead byte 0x2e.
KSC5601-1987 (Wansung) lead byte 0x2f.KSC5601-1987 (Wansung) lead byte 0x2f.KSC5601-1987 (Wansung) lead byte 0x2f.KSC5601-1987 (Wansung) lead byte 0x2f.
KSC5601-1987 (Wansung) lead byte 0x30.KSC5601-1987 (Wansung) lead byte 0x30.KSC5601-1987 (Wansung) lead byte 0x30.KSC5601-1987 (Wansung) lead byte 0x30.
KSC5601-1987 (Wansung) lead byte 0x31.KSC5601-1987 (Wansung) lead byte 0x31.KSC5601-1987 (Wansung) lead byte 0x31.KSC5601-1987 (Wansung) lead byte 0x31.
KSC5601-1987 (Wansung) lead byte 0x32.KSC5601-1987 (Wansung) lead byte 0x32.KSC5601-1987 (Wansung) lead byte 0x32.KSC5601-1987 (Wansung) lead byte 0x32.
KSC5601-1987 (Wansung) lead byte 0x33.KSC5601-1987 (Wansung) lead byte 0x33.KSC5601-1987 (Wansung) lead byte 0x33.KSC5601-1987 (Wansung) lead byte 0x33.
KSC5601-1987 (Wansung) lead byte 0x34.KSC5601-1987 (Wansung) lead byte 0x34.KSC5601-1987 (Wansung) lead byte 0x34.KSC5601-1987 (Wansung) lead byte 0x34.
KSC5601-1987 (Wansung) lead byte 0x35.KSC5601-1987 (Wansung) lead byte 0x35.KSC5601-1987 (Wansung) lead byte 0x35.KSC5601-1987 (Wansung) lead byte 0x35.
KSC5601-1987 (Wansung) lead byte 0x36.KSC5601-1987 (Wansung) lead byte 0x36.KSC5601-1987 (Wansung) lead byte 0x36.KSC5601-1987 (Wansung) lead byte 0x36.
KSC5601-1987 (Wansung) lead byte 0x37.KSC5601-1987 (Wansung) lead byte 0x37.KSC5601-1987 (Wansung) lead byte 0x37.KSC5601-1987 (Wansung) lead byte 0x37.
KSC5601-1987 (Wansung) lead byte 0x38.KSC5601-1987 (Wansung) lead byte 0x38.KSC5601-1987 (Wansung) lead byte 0x38.KSC5601-1987 (Wansung) lead byte 0x38.
KSC5601-1987 (Wansung) lead byte 0x39.KSC5601-1987 (Wansung) lead byte 0x39.KSC5601-1987 (Wansung) lead byte 0x39.KSC5601-1987 (Wansung) lead byte 0x39.
KSC5601-1987 (Wansung) lead byte 0x3a.KSC5601-1987 (Wansung) lead byte 0x3a.KSC5601-1987 (Wansung) lead byte 0x3a.KSC5601-1987 (Wansung) lead byte 0x3a.
KSC5601-1987 (Wansung) lead byte 0x3b.KSC5601-1987 (Wansung) lead byte 0x3b.KSC5601-1987 (Wansung) lead byte 0x3b.KSC5601-1987 (Wansung) lead byte 0x3b.
KSC5601-1987 (Wansung) lead byte 0x3c.KSC5601-1987 (Wansung) lead byte 0x3c.KSC5601-1987 (Wansung) lead byte 0x3c.KSC5601-1987 (Wansung) lead byte 0x3c.
KSC5601-1987 (Wansung) lead byte 0x3d.KSC5601-1987 (Wansung) lead byte 0x3d.KSC5601-1987 (Wansung) lead byte 0x3d.KSC5601-1987 (Wansung) lead byte 0x3d.
KSC5601-1987 (Wansung) lead byte 0x3e.KSC5601-1987 (Wansung) lead byte 0x3e.KSC5601-1987 (Wansung) lead byte 0x3e.KSC5601-1987 (Wansung) lead byte 0x3e.
KSC5601-1987 (Wansung) lead byte 0x3f.KSC5601-1987 (Wansung) lead byte 0x3f.KSC5601-1987 (Wansung) lead byte 0x3f.KSC5601-1987 (Wansung) lead byte 0x3f.
KSC5601-1987 (Wansung) lead byte 0x40.KSC5601-1987 (Wansung) lead byte 0x40.KSC5601-1987 (Wansung) lead byte 0x40.KSC5601-1987 (Wansung) lead byte 0x40.
KSC5601-1987 (Wansung) lead byte 0x41.KSC5601-1987 (Wansung) lead byte 0x41.KSC5601-1987 (Wansung) lead byte 0x41.KSC5601-1987 (Wansung) lead byte 0x41.
KSC5601-1987 (Wansung) lead byte 0x42.KSC5601-1987 (Wansung) lead byte 0x42.KSC5601-1987 (Wansung) lead byte 0x42.KSC5601-1987 (Wansung) lead byte 0x42.
KSC5601-1987 (Wansung) lead byte 0x43.KSC5601-1987 (Wansung) lead byte 0x43.KSC5601-1987 (Wansung) lead byte 0x43.KSC5601-1987 (Wansung) lead byte 0x43.
KSC5601-1987 (Wansung) lead byte 0x44.KSC5601-1987 (Wansung) lead byte 0x44.KSC5601-1987 (Wansung) lead byte 0x44.KSC5601-1987 (Wansung) lead byte 0x44.
KSC5601-1987 (Wansung) lead byte 0x45.KSC5601-1987 (Wansung) lead byte 0x45.KSC5601-1987 (Wansung) lead byte 0x45.KSC5601-1987 (Wansung) lead byte 0x45.
KSC5601-1987 (Wansung) lead byte 0x46.KSC5601-1987 (Wansung) lead byte 0x46.KSC5601-1987 (Wansung) lead byte 0x46.KSC5601-1987 (Wansung) lead byte 0x46.
KSC5601-1987 (Wansung) lead byte 0x47.KSC5601-1987 (Wansung) lead byte 0x47.KSC5601-1987 (Wansung) lead byte 0x47.KSC5601-1987 (Wansung) lead byte 0x47.
KSC5601-1987 (Wansung) lead byte 0x48.KSC5601-1987 (Wansung) lead byte 0x48.KSC5601-1987 (Wansung) lead byte 0x48.KSC5601-1987 (Wansung) lead byte 0x48.
KSC5601-1987 (Wansung) lead byte 0x49.KSC5601-1987 (Wansung) lead byte 0x49.KSC5601-1987 (Wansung) lead byte 0x49.KSC5601-1987 (Wansung) lead byte 0x49.
KSC5601-1987 (Wansung) lead byte 0x4a.KSC5601-1987 (Wansung) lead byte 0x4a.KSC5601-1987 (Wansung) lead byte 0x4a.KSC5601-1987 (Wansung) lead byte 0x4a.
KSC5601-1987 (Wansung) lead byte 0x4b.KSC5601-1987 (Wansung) lead byte 0x4b.KSC5601-1987 (Wansung) lead byte 0x4b.KSC5601-1987 (Wansung) lead byte 0x4b.
KSC5601-1987 (Wansung) lead byte 0x4c.KSC5601-1987 (Wansung) lead byte 0x4c.KSC5601-1987 (Wansung) lead byte 0x4c.KSC5601-1987 (Wansung) lead byte 0x4c.
KSC5601-1987 (Wansung) lead byte 0x4d.KSC5601-1987 (Wansung) lead byte 0x4d.KSC5601-1987 (Wansung) lead byte 0x4d.KSC5601-1987 (Wansung) lead byte 0x4d.
KSC5601-1987 (Wansung) lead byte 0x4e.KSC5601-1987 (Wansung) lead byte 0x4e.KSC5601-1987 (Wansung) lead byte 0x4e.KSC5601-1987 (Wansung) lead byte 0x4e.
KSC5601-1987 (Wansung) lead byte 0x4f.KSC5601-1987 (Wansung) lead byte 0x4f.KSC5601-1987 (Wansung) lead byte 0x4f.KSC5601-1987 (Wansung) lead byte 0x4f.
KSC5601-1987 (Wansung) lead byte 0x50.KSC5601-1987 (Wansung) lead byte 0x50.KSC5601-1987 (Wansung) lead byte 0x50.KSC5601-1987 (Wansung) lead byte 0x50.
KSC5601-1987 (Wansung) lead byte 0x51.KSC5601-1987 (Wansung) lead byte 0x51.KSC5601-1987 (Wansung) lead byte 0x51.KSC5601-1987 (Wansung) lead byte 0x51.
KSC5601-1987 (Wansung) lead byte 0x52.KSC5601-1987 (Wansung) lead byte 0x52.KSC5601-1987 (Wansung) lead byte 0x52.KSC5601-1987 (Wansung) lead byte 0x52.
KSC5601-1987 (Wansung) lead byte 0x53.KSC5601-1987 (Wansung) lead byte 0x53.KSC5601-1987 (Wansung) lead byte 0x53.KSC5601-1987 (Wansung) lead byte 0x53.
KSC5601-1987 (Wansung) lead byte 0x54.KSC5601-1987 (Wansung) lead byte 0x54.KSC5601-1987 (Wansung) lead byte 0x54.KSC5601-1987 (Wansung) lead byte 0x54.
KSC5601-1987 (Wansung) lead byte 0x55.KSC5601-1987 (Wansung) lead byte 0x55.KSC5601-1987 (Wansung) lead byte 0x55.KSC5601-1987 (Wansung) lead byte 0x55.
KSC5601-1987 (Wansung) lead byte 0x56.KSC5601-1987 (Wansung) lead byte 0x56.KSC5601-1987 (Wansung) lead byte 0x56.KSC5601-1987 (Wansung) lead byte 0x56.
KSC5601-1987 (Wansung) lead byte 0x57.KSC5601-1987 (Wansung) lead byte 0x57.KSC5601-1987 (Wansung) lead byte 0x57.KSC5601-1987 (Wansung) lead byte 0x57.
KSC5601-1987 (Wansung) lead byte 0x58.KSC5601-1987 (Wansung) lead byte 0x58.KSC5601-1987 (Wansung) lead byte 0x58.KSC5601-1987 (Wansung) lead byte 0x58.
KSC5601-1987 (Wansung) lead byte 0x59.KSC5601-1987 (Wansung) lead byte 0x59.KSC5601-1987 (Wansung) lead byte 0x59.KSC5601-1987 (Wansung) lead byte 0x59.
KSC5601-1987 (Wansung) lead byte 0x5a.KSC5601-1987 (Wansung) lead byte 0x5a.KSC5601-1987 (Wansung) lead byte 0x5a.KSC5601-1987 (Wansung) lead byte 0x5a.
KSC5601-1987 (Wansung) lead byte 0x5b.KSC5601-1987 (Wansung) lead byte 0x5b.KSC5601-1987 (Wansung) lead byte 0x5b.KSC5601-1987 (Wansung) lead byte 0x5b.
KSC5601-1987 (Wansung) lead byte 0x5c.KSC5601-1987 (Wansung) lead byte 0x5c.KSC5601-1987 (Wansung) lead byte 0x5c.KSC5601-1987 (Wansung) lead byte 0x5c.
KSC5601-1987 (Wansung) lead byte 0x5d.KSC5601-1987 (Wansung) lead byte 0x5d.KSC5601-1987 (Wansung) lead byte 0x5d.KSC5601-1987 (Wansung) lead byte 0x5d.
KSC5601-1987 (Wansung) lead byte 0x5e.KSC5601-1987 (Wansung) lead byte 0x5e.KSC5601-1987 (Wansung) lead byte 0x5e.KSC5601-1987 (Wansung) lead byte 0x5e.
KSC5601-1987 (Wansung) lead byte 0x5f.KSC5601-1987 (Wansung) lead byte 0x5f.KSC5601-1987 (Wansung) lead byte 0x5f.KSC5601-1987 (Wansung) lead byte 0x5f.
KSC5601-1987 (Wansung) lead byte 0x60.KSC5601-1987 (Wansung) lead byte 0x60.KSC5601-1987 (Wansung) lead byte 0x60.KSC5601-1987 (Wansung) lead byte 0x60.
KSC5601-1987 (Wansung) lead byte 0x61.KSC5601-1987 (Wansung) lead byte 0x61.KSC5601-1987 (Wansung) lead byte 0x61.KSC5601-1987 (Wansung) lead byte 0x61.
KSC5601-1987 (Wansung) lead byte 0x62.KSC5601-1987 (Wansung) lead byte 0x62.KSC5601-1987 (Wansung) lead byte 0x62.KSC5601-1987 (Wansung) lead byte 0x62.
KSC5601-1987 (Wansung) lead byte 0x63.KSC5601-1987 (Wansung) lead byte 0x63.KSC5601-1987 (Wansung) lead byte 0x63.KSC5601-1987 (Wansung) lead byte 0x63.
KSC5601-1987 (Wansung) lead byte 0x64.KSC5601-1987 (Wansung) lead byte 0x64.KSC5601-1987 (Wansung) lead byte 0x64.KSC5601-1987 (Wansung) lead byte 0x64.
KSC5601-1987 (Wansung) lead byte 0x65.KSC5601-1987 (Wansung) lead byte 0x65.KSC5601-1987 (Wansung) lead byte 0x65.KSC5601-1987 (Wansung) lead byte 0x65.
KSC5601-1987 (Wansung) lead byte 0x66.KSC5601-1987 (Wansung) lead byte 0x66.KSC5601-1987 (Wansung) lead byte 0x66.KSC5601-1987 (Wansung) lead byte 0x66.
KSC5601-1987 (Wansung) lead byte 0x67.KSC5601-1987 (Wansung) lead byte 0x67.KSC5601-1987 (Wansung) lead byte 0x67.KSC5601-1987 (Wansung) lead byte 0x67.
KSC5601-1987 (Wansung) lead byte 0x68.KSC5601-1987 (Wansung) lead byte 0x68.KSC5601-1987 (Wansung) lead byte 0x68.KSC5601-1987 (Wansung) lead byte 0x68.
KSC5601-1987 (Wansung) lead byte 0x69.KSC5601-1987 (Wansung) lead byte 0x69.KSC5601-1987 (Wansung) lead byte 0x69.KSC5601-1987 (Wansung) lead byte 0x69.
KSC5601-1987 (Wansung) lead byte 0x6a.KSC5601-1987 (Wansung) lead byte 0x6a.KSC5601-1987 (Wansung) lead byte 0x6a.KSC5601-1987 (Wansung) lead byte 0x6a.
KSC5601-1987 (Wansung) lead byte 0x6b.KSC5601-1987 (Wansung) lead byte 0x6b.KSC5601-1987 (Wansung) lead byte 0x6b.KSC5601-1987 (Wansung) lead byte 0x6b.
KSC5601-1987 (Wansung) lead byte 0x6c.KSC5601-1987 (Wansung) lead byte 0x6c.KSC5601-1987 (Wansung) lead byte 0x6c.KSC5601-1987 (Wansung) lead byte 0x6c.
KSC5601-1987 (Wansung) lead byte 0x6d.KSC5601-1987 (Wansung) lead byte 0x6d.KSC5601-1987 (Wansung) lead byte 0x6d.KSC5601-1987 (Wansung) lead byte 0x6d.
KSC5601-1987 (Wansung) lead byte 0x6e.KSC5601-1987 (Wansung) lead byte 0x6e.KSC5601-1987 (Wansung) lead byte 0x6e.KSC5601-1987 (Wansung) lead byte 0x6e.
KSC5601-1987 (Wansung) lead byte 0x6f.KSC5601-1987 (Wansung) lead byte 0x6f.KSC5601-1987 (Wansung) lead byte 0x6f.KSC5601-1987 (Wansung) lead byte 0x6f.
KSC5601-1987 (Wansung) lead byte 0x70.KSC5601-1987 (Wansung) lead byte 0x70.KSC5601-1987 (Wansung) lead byte 0x70.KSC5601-1987 (Wansung) lead byte 0x70.
KSC5601-1987 (Wansung) lead byte 0x71.KSC5601-1987 (Wansung) lead byte 0x71.KSC5601-1987 (Wansung) lead byte 0x71.KSC5601-1987 (Wansung) lead byte 0x71.
KSC5601-1987 (Wansung) lead byte 0x72.KSC5601-1987 (Wansung) lead byte 0x72.KSC5601-1987 (Wansung) lead byte 0x72.KSC5601-1987 (Wansung) lead byte 0x72.
KSC5601-1987 (Wansung) lead byte 0x73.KSC5601-1987 (Wansung) lead byte 0x73.KSC5601-1987 (Wansung) lead byte 0x73.KSC5601-1987 (Wansung) lead byte 0x73.
KSC5601-1987 (Wansung) lead byte 0x74.KSC5601-1987 (Wansung) lead byte 0x74.KSC5601-1987 (Wansung) lead byte 0x74.KSC5601-1987 (Wansung) lead byte 0x74.
KSC5601-1987 (Wansung) lead byte 0x75.KSC5601-1987 (Wansung) lead byte 0x75.KSC5601-1987 (Wansung) lead byte 0x75.KSC5601-1987 (Wansung) lead byte 0x75.
KSC5601-1987 (Wansung) lead byte 0x76.KSC5601-1987 (Wansung) lead byte 0x76.KSC5601-1987 (Wansung) lead byte 0x76.KSC5601-1987 (Wansung) lead byte 0x76.
KSC5601-1987 (Wansung) lead byte 0x77.KSC5601-1987 (Wansung) lead byte 0x77.KSC5601-1987 (Wansung) lead byte 0x77.KSC5601-1987 (Wansung) lead byte 0x77.
KSC5601-1987 (Wansung) lead byte 0x78.KSC5601-1987 (Wansung) lead byte 0x78.KSC5601-1987 (Wansung) lead byte 0x78.KSC5601-1987 (Wansung) lead byte 0x78.
KSC5601-1987 (Wansung) lead byte 0x79.KSC5601-1987 (Wansung) lead byte 0x79.KSC5601-1987 (Wansung) lead byte 0x79.KSC5601-1987 (Wansung) lead byte 0x79.
KSC5601-1987 (Wansung) lead byte 0x7a.KSC5601-1987 (Wansung) lead byte 0x7a.KSC5601-1987 (Wansung) lead byte 0x7a.KSC5601-1987 (Wansung) lead byte 0x7a.
KSC5601-1987 (Wansung) lead byte 0x7b.KSC5601-1987 (Wansung) lead byte 0x7b.KSC5601-1987 (Wansung) lead byte 0x7b.KSC5601-1987 (Wansung) lead byte 0x7b.
KSC5601-1987 (Wansung) lead byte 0x7c.KSC5601-1987 (Wansung) lead byte 0x7c.KSC5601-1987 (Wansung) lead byte 0x7c.KSC5601-1987 (Wansung) lead byte 0x7c.
KSC5601-1987 (Wansung) lead byte 0x7d.KSC5601-1987 (Wansung) lead byte 0x7d.KSC5601-1987 (Wansung) lead byte 0x7d.KSC5601-1987 (Wansung) lead byte 0x7d.
KSC5601-1992 (Johab) lead byte 0x81.KSC5601-1992 (Johab) lead byte 0x81.KSC5601-1992 (Johab) lead byte 0x81.KSC5601-1992 (Johab) lead byte 0x81.
KSC5601-1992 (Johab) lead byte 0x82.KSC5601-1992 (Johab) lead byte 0x82.KSC5601-1992 (Johab) lead byte 0x82.KSC5601-1992 (Johab) lead byte 0x82.
KSC5601-1992 (Johab) lead byte 0x83.KSC5601-1992 (Johab) lead byte 0x83.KSC5601-1992 (Johab) lead byte 0x83.KSC5601-1992 (Johab) lead byte 0x83.
KSC5601-1992 (Johab) lead byte 0x84.KSC5601-1992 (Johab) lead byte 0x84.KSC5601-1992 (Johab) lead byte 0x84.KSC5601-1992 (Johab) lead byte 0x84.
KSC5601-1992 (Johab) lead byte 0x85.KSC5601-1992 (Johab) lead byte 0x85.KSC5601-1992 (Johab) lead byte 0x85.KSC5601-1992 (Johab) lead byte 0x85.
KSC5601-1992 (Johab) lead byte 0x86.KSC5601-1992 (Johab) lead byte 0x86.KSC5601-1992 (Johab) lead byte 0x86.KSC5601-1992 (Johab) lead byte 0x86.
KSC5601-1992 (Johab) lead byte 0x87.KSC5601-1992 (Johab) lead byte 0x87.KSC5601-1992 (Johab) lead byte 0x87.KSC5601-1992 (Johab) lead byte 0x87.
KSC5601-1992 (Johab) lead byte 0x88.KSC5601-1992 (Johab) lead byte 0x88.KSC5601-1992 (Johab) lead byte 0x88.KSC5601-1992 (Johab) lead byte 0x88.
KSC5601-1992 (Johab) lead byte 0x89.KSC5601-1992 (Johab) lead byte 0x89.KSC5601-1992 (Johab) lead byte 0x89.KSC5601-1992 (Johab) lead byte 0x89.
KSC5601-1992 (Johab) lead byte 0x8a.KSC5601-1992 (Johab) lead byte 0x8a.KSC5601-1992 (Johab) lead byte 0x8a.KSC5601-1992 (Johab) lead byte 0x8a.
KSC5601-1992 (Johab) lead byte 0x8b.KSC5601-1992 (Johab) lead byte 0x8b.KSC5601-1992 (Johab) lead byte 0x8b.KSC5601-1992 (Johab) lead byte 0x8b.
KSC5601-1992 (Johab) lead byte 0x8c.KSC5601-1992 (Johab) lead byte 0x8c.KSC5601-1992 (Johab) lead byte 0x8c.KSC5601-1992 (Johab) lead byte 0x8c.
KSC5601-1992 (Johab) lead byte 0x8d.KSC5601-1992 (Johab) lead byte 0x8d.KSC5601-1992 (Johab) lead byte 0x8d.KSC5601-1992 (Johab) lead byte 0x8d.
KSC5601-1992 (Johab) lead byte 0x8e.KSC5601-1992 (Johab) lead byte 0x8e.KSC5601-1992 (Johab) lead byte 0x8e.KSC5601-1992 (Johab) lead byte 0x8e.
KSC5601-1992 (Johab) lead byte 0x8f.KSC5601-1992 (Johab) lead byte 0x8f.KSC5601-1992 (Johab) lead byte 0x8f.KSC5601-1992 (Johab) lead byte 0x8f.
KSC5601-1992 (Johab) lead byte 0x90.KSC5601-1992 (Johab) lead byte 0x90.KSC5601-1992 (Johab) lead byte 0x90.KSC5601-1992 (Johab) lead byte 0x90.
KSC5601-1992 (Johab) lead byte 0x91.KSC5601-1992 (Johab) lead byte 0x91.KSC5601-1992 (Johab) lead byte 0x91.KSC5601-1992 (Johab) lead byte 0x91.
KSC5601-1992 (Johab) lead byte 0x92.KSC5601-1992 (Johab) lead byte 0x92.KSC5601-1992 (Johab) lead byte 0x92.KSC5601-1992 (Johab) lead byte 0x92.
KSC5601-1992 (Johab) lead byte 0x93.KSC5601-1992 (Johab) lead byte 0x93.KSC5601-1992 (Johab) lead byte 0x93.KSC5601-1992 (Johab) lead byte 0x93.
KSC5601-1992 (Johab) lead byte 0x94.KSC5601-1992 (Johab) lead byte 0x94.KSC5601-1992 (Johab) lead byte 0x94.KSC5601-1992 (Johab) lead byte 0x94.
KSC5601-1992 (Johab) lead byte 0x95.KSC5601-1992 (Johab) lead byte 0x95.KSC5601-1992 (Johab) lead byte 0x95.KSC5601-1992 (Johab) lead byte 0x95.
KSC5601-1992 (Johab) lead byte 0x96.KSC5601-1992 (Johab) lead byte 0x96.KSC5601-1992 (Johab) lead byte 0x96.KSC5601-1992 (Johab) lead byte 0x96.
KSC5601-1992 (Johab) lead byte 0x97.KSC5601-1992 (Johab) lead byte 0x97.KSC5601-1992 (Johab) lead byte 0x97.KSC5601-1992 (Johab) lead byte 0x97.
KSC5601-1992 (Johab) lead byte 0x98.KSC5601-1992 (Johab) lead byte 0x98.KSC5601-1992 (Johab) lead byte 0x98.KSC5601-1992 (Johab) lead byte 0x98.
KSC5601-1992 (Johab) lead byte 0x99.KSC5601-1992 (Johab) lead byte 0x99.KSC5601-1992 (Johab) lead byte 0x99.KSC5601-1992 (Johab) lead byte 0x99.
KSC5601-1992 (Johab) lead byte 0x9a.KSC5601-1992 (Johab) lead byte 0x9a.KSC5601-1992 (Johab) lead byte 0x9a.KSC5601-1992 (Johab) lead byte 0x9a.
KSC5601-1992 (Johab) lead byte 0x9b.KSC5601-1992 (Johab) lead byte 0x9b.KSC5601-1992 (Johab) lead byte 0x9b.KSC5601-1992 (Johab) lead byte 0x9b.
KSC5601-1992 (Johab) lead byte 0x9c.KSC5601-1992 (Johab) lead byte 0x9c.KSC5601-1992 (Johab) lead byte 0x9c.KSC5601-1992 (Johab) lead byte 0x9c.
KSC5601-1992 (Johab) lead byte 0x9d.KSC5601-1992 (Johab) lead byte 0x9d.KSC5601-1992 (Johab) lead byte 0x9d.KSC5601-1992 (Johab) lead byte 0x9d.
KSC5601-1992 (Johab) lead byte 0x9e.KSC5601-1992 (Johab) lead byte 0x9e.KSC5601-1992 (Johab) lead byte 0x9e.KSC5601-1992 (Johab) lead byte 0x9e.
KSC5601-1992 (Johab) lead byte 0x9f.KSC5601-1992 (Johab) lead byte 0x9f.KSC5601-1992 (Johab) lead byte 0x9f.KSC5601-1992 (Johab) lead byte 0x9f.
KSC5601-1992 (Johab) lead byte 0xa0.KSC5601-1992 (Johab) lead byte 0xa0.KSC5601-1992 (Johab) lead byte 0xa0.KSC5601-1992 (Johab) lead byte 0xa0.
KSC5601-1992 (Johab) lead byte 0xa1.KSC5601-1992 (Johab) lead byte 0xa1.KSC5601-1992 (Johab) lead byte 0xa1.KSC5601-1992 (Johab) lead byte 0xa1.
KSC5601-1992 (Johab) lead byte 0xa2.KSC5601-1992 (Johab) lead byte 0xa2.KSC5601-1992 (Johab) lead byte 0xa2.KSC5601-1992 (Johab) lead byte 0xa2.
KSC5601-1992 (Johab) lead byte 0xa3.KSC5601-1992 (Johab) lead byte 0xa3.KSC5601-1992 (Johab) lead byte 0xa3.KSC5601-1992 (Johab) lead byte 0xa3.
KSC5601-1992 (Johab) lead byte 0xa4.KSC5601-1992 (Johab) lead byte 0xa4.KSC5601-1992 (Johab) lead byte 0xa4.KSC5601-1992 (Johab) lead byte 0xa4.
KSC5601-1992 (Johab) lead byte 0xa5.KSC5601-1992 (Johab) lead byte 0xa5.KSC5601-1992 (Johab) lead byte 0xa5.KSC5601-1992 (Johab) lead byte 0xa5.
KSC5601-1992 (Johab) lead byte 0xa6.KSC5601-1992 (Johab) lead byte 0xa6.KSC5601-1992 (Johab) lead byte 0xa6.KSC5601-1992 (Johab) lead byte 0xa6.
KSC5601-1992 (Johab) lead byte 0xa7.KSC5601-1992 (Johab) lead byte 0xa7.KSC5601-1992 (Johab) lead byte 0xa7.KSC5601-1992 (Johab) lead byte 0xa7.
KSC5601-1992 (Johab) lead byte 0xa8.KSC5601-1992 (Johab) lead byte 0xa8.KSC5601-1992 (Johab) lead byte 0xa8.KSC5601-1992 (Johab) lead byte 0xa8.
KSC5601-1992 (Johab) lead byte 0xa9.KSC5601-1992 (Johab) lead byte 0xa9.KSC5601-1992 (Johab) lead byte 0xa9.KSC5601-1992 (Johab) lead byte 0xa9.
KSC5601-1992 (Johab) lead byte 0xaa.KSC5601-1992 (Johab) lead byte 0xaa.KSC5601-1992 (Johab) lead byte 0xaa.KSC5601-1992 (Johab) lead byte 0xaa.
KSC5601-1992 (Johab) lead byte 0xab.KSC5601-1992 (Johab) lead byte 0xab.KSC5601-1992 (Johab) lead byte 0xab.KSC5601-1992 (Johab) lead byte 0xab.
KSC5601-1992 (Johab) lead byte 0xac.KSC5601-1992 (Johab) lead byte 0xac.KSC5601-1992 (Johab) lead byte 0xac.KSC5601-1992 (Johab) lead byte 0xac.
KSC5601-1992 (Johab) lead byte 0xad.KSC5601-1992 (Johab) lead byte 0xad.KSC5601-1992 (Johab) lead byte 0xad.KSC5601-1992 (Johab) lead byte 0xad.
KSC5601-1992 (Johab) lead byte 0xae.KSC5601-1992 (Johab) lead byte 0xae.KSC5601-1992 (Johab) lead byte 0xae.KSC5601-1992 (Johab) lead byte 0xae.
KSC5601-1992 (Johab) lead byte 0xaf.KSC5601-1992 (Johab) lead byte 0xaf.KSC5601-1992 (Johab) lead byte 0xaf.KSC5601-1992 (Johab) lead byte 0xaf.
KSC5601-1992 (Johab) lead byte 0xb0.KSC5601-1992 (Johab) lead byte 0xb0.KSC5601-1992 (Johab) lead byte 0xb0.KSC5601-1992 (Johab) lead byte 0xb0.
KSC5601-1992 (Johab) lead byte 0xb1.KSC5601-1992 (Johab) lead byte 0xb1.KSC5601-1992 (Johab) lead byte 0xb1.KSC5601-1992 (Johab) lead byte 0xb1.
KSC5601-1992 (Johab) lead byte 0xb2.KSC5601-1992 (Johab) lead byte 0xb2.KSC5601-1992 (Johab) lead byte 0xb2.KSC5601-1992 (Johab) lead byte 0xb2.
KSC5601-1992 (Johab) lead byte 0xb3.KSC5601-1992 (Johab) lead byte 0xb3.KSC5601-1992 (Johab) lead byte 0xb3.KSC5601-1992 (Johab) lead byte 0xb3.
KSC5601-1992 (Johab) lead byte 0xb4.KSC5601-1992 (Johab) lead byte 0xb4.KSC5601-1992 (Johab) lead byte 0xb4.KSC5601-1992 (Johab) lead byte 0xb4.
KSC5601-1992 (Johab) lead byte 0xb5.KSC5601-1992 (Johab) lead byte 0xb5.KSC5601-1992 (Johab) lead byte 0xb5.KSC5601-1992 (Johab) lead byte 0xb5.
KSC5601-1992 (Johab) lead byte 0xb6.KSC5601-1992 (Johab) lead byte 0xb6.KSC5601-1992 (Johab) lead byte 0xb6.KSC5601-1992 (Johab) lead byte 0xb6.
KSC5601-1992 (Johab) lead byte 0xb7.KSC5601-1992 (Johab) lead byte 0xb7.KSC5601-1992 (Johab) lead byte 0xb7.KSC5601-1992 (Johab) lead byte 0xb7.
KSC5601-1992 (Johab) lead byte 0xb8.KSC5601-1992 (Johab) lead byte 0xb8.KSC5601-1992 (Johab) lead byte 0xb8.KSC5601-1992 (Johab) lead byte 0xb8.
KSC5601-1992 (Johab) lead byte 0xb9.KSC5601-1992 (Johab) lead byte 0xb9.KSC5601-1992 (Johab) lead byte 0xb9.KSC5601-1992 (Johab) lead byte 0xb9.
KSC5601-1992 (Johab) lead byte 0xba.KSC5601-1992 (Johab) lead byte 0xba.KSC5601-1992 (Johab) lead byte 0xba.KSC5601-1992 (Johab) lead byte 0xba.
KSC5601-1992 (Johab) lead byte 0xbb.KSC5601-1992 (Johab) lead byte 0xbb.KSC5601-1992 (Johab) lead byte 0xbb.KSC5601-1992 (Johab) lead byte 0xbb.
KSC5601-1992 (Johab) lead byte 0xbc.KSC5601-1992 (Johab) lead byte 0xbc.KSC5601-1992 (Johab) lead byte 0xbc.KSC5601-1992 (Johab) lead byte 0xbc.
KSC5601-1992 (Johab) lead byte 0xbd.KSC5601-1992 (Johab) lead byte 0xbd.KSC5601-1992 (Johab) lead byte 0xbd.KSC5601-1992 (Johab) lead byte 0xbd.
KSC5601-1992 (Johab) lead byte 0xbe.KSC5601-1992 (Johab) lead byte 0xbe.KSC5601-1992 (Johab) lead byte 0xbe.KSC5601-1992 (Johab) lead byte 0xbe.
KSC5601-1992 (Johab) lead byte 0xbf.KSC5601-1992 (Johab) lead byte 0xbf.KSC5601-1992 (Johab) lead byte 0xbf.KSC5601-1992 (Johab) lead byte 0xbf.
KSC5601-1992 (Johab) lead byte 0xc0.KSC5601-1992 (Johab) lead byte 0xc0.KSC5601-1992 (Johab) lead byte 0xc0.KSC5601-1992 (Johab) lead byte 0xc0.
KSC5601-1992 (Johab) lead byte 0xc1.KSC5601-1992 (Johab) lead byte 0xc1.KSC5601-1992 (Johab) lead byte 0xc1.KSC5601-1992 (Johab) lead byte 0xc1.
KSC5601-1992 (Johab) lead byte 0xc2.KSC5601-1992 (Johab) lead byte 0xc2.KSC5601-1992 (Johab) lead byte 0xc2.KSC5601-1992 (Johab) lead byte 0xc2.
KSC5601-1992 (Johab) lead byte 0xc3.KSC5601-1992 (Johab) lead byte 0xc3.KSC5601-1992 (Johab) lead byte 0xc3.KSC5601-1992 (Johab) lead byte 0xc3.
KSC5601-1992 (Johab) lead byte 0xc4.KSC5601-1992 (Johab) lead byte 0xc4.KSC5601-1992 (Johab) lead byte 0xc4.KSC5601-1992 (Johab) lead byte 0xc4.
KSC5601-1992 (Johab) lead byte 0xc5.KSC5601-1992 (Johab) lead byte 0xc5.KSC5601-1992 (Johab) lead byte 0xc5.KSC5601-1992 (Johab) lead byte 0xc5.
KSC5601-1992 (Johab) lead byte 0xc6.KSC5601-1992 (Johab) lead byte 0xc6.KSC5601-1992 (Johab) lead byte 0xc6.KSC5601-1992 (Johab) lead byte 0xc6.
KSC5601-1992 (Johab) lead byte 0xc7.KSC5601-1992 (Johab) lead byte 0xc7.KSC5601-1992 (Johab) lead byte 0xc7.KSC5601-1992 (Johab) lead byte 0xc7.
KSC5601-1992 (Johab) lead byte 0xc8.KSC5601-1992 (Johab) lead byte 0xc8.KSC5601-1992 (Johab) lead byte 0xc8.KSC5601-1992 (Johab) lead byte 0xc8.
KSC5601-1992 (Johab) lead byte 0xc9.KSC5601-1992 (Johab) lead byte 0xc9.KSC5601-1992 (Johab) lead byte 0xc9.KSC5601-1992 (Johab) lead byte 0xc9.
KSC5601-1992 (Johab) lead byte 0xca.KSC5601-1992 (Johab) lead byte 0xca.KSC5601-1992 (Johab) lead byte 0xca.KSC5601-1992 (Johab) lead byte 0xca.
KSC5601-1992 (Johab) lead byte 0xcb.KSC5601-1992 (Johab) lead byte 0xcb.KSC5601-1992 (Johab) lead byte 0xcb.KSC5601-1992 (Johab) lead byte 0xcb.
KSC5601-1992 (Johab) lead byte 0xcc.KSC5601-1992 (Johab) lead byte 0xcc.KSC5601-1992 (Johab) lead byte 0xcc.KSC5601-1992 (Johab) lead byte 0xcc.
KSC5601-1992 (Johab) lead byte 0xcd.KSC5601-1992 (Johab) lead byte 0xcd.KSC5601-1992 (Johab) lead byte 0xcd.KSC5601-1992 (Johab) lead byte 0xcd.
KSC5601-1992 (Johab) lead byte 0xce.KSC5601-1992 (Johab) lead byte 0xce.KSC5601-1992 (Johab) lead byte 0xce.KSC5601-1992 (Johab) lead byte 0xce.
KSC5601-1992 (Johab) lead byte 0xcf.KSC5601-1992 (Johab) lead byte 0xcf.KSC5601-1992 (Johab) lead byte 0xcf.KSC5601-1992 (Johab) lead byte 0xcf.
KSC5601-1992 (Johab) lead byte 0xd0.KSC5601-1992 (Johab) lead byte 0xd0.KSC5601-1992 (Johab) lead byte 0xd0.KSC5601-1992 (Johab) lead byte 0xd0.
KSC5601-1992 (Johab) lead byte 0xd1.KSC5601-1992 (Johab) lead byte 0xd1.KSC5601-1992 (Johab) lead byte 0xd1.KSC5601-1992 (Johab) lead byte 0xd1.
KSC5601-1992 (Johab) lead byte 0xd2.KSC5601-1992 (Johab) lead byte 0xd2.KSC5601-1992 (Johab) lead byte 0xd2.KSC5601-1992 (Johab) lead byte 0xd2.
KSC5601-1992 (Johab) lead byte 0xd3.KSC5601-1992 (Johab) lead byte 0xd3.KSC5601-1992 (Johab) lead byte 0xd3.KSC5601-1992 (Johab) lead byte 0xd3.
KSC5601-1992 (Johab) lead byte 0xd4.KSC5601-1992 (Johab) lead byte 0xd4.KSC5601-1992 (Johab) lead byte 0xd4.KSC5601-1992 (Johab) lead byte 0xd4.
KSC5601-1992 (Johab) lead byte 0xd5.KSC5601-1992 (Johab) lead byte 0xd5.KSC5601-1992 (Johab) lead byte 0xd5.KSC5601-1992 (Johab) lead byte 0xd5.
KSC5601-1992 (Johab) lead byte 0xd6.KSC5601-1992 (Johab) lead byte 0xd6.KSC5601-1992 (Johab) lead byte 0xd6.KSC5601-1992 (Johab) lead byte 0xd6.
KSC5601-1992 (Johab) lead byte 0xd7.KSC5601-1992 (Johab) lead byte 0xd7.KSC5601-1992 (Johab) lead byte 0xd7.KSC5601-1992 (Johab) lead byte 0xd7.
KSC5601-1992 (Johab) lead byte 0xd8.KSC5601-1992 (Johab) lead byte 0xd8.KSC5601-1992 (Johab) lead byte 0xd8.KSC5601-1992 (Johab) lead byte 0xd8.
KSC5601-1992 (Johab) lead byte 0xd9.KSC5601-1992 (Johab) lead byte 0xd9.KSC5601-1992 (Johab) lead byte 0xd9.KSC5601-1992 (Johab) lead byte 0xd9.
KSC5601-1992 (Johab) lead byte 0xda.KSC5601-1992 (Johab) lead byte 0xda.KSC5601-1992 (Johab) lead byte 0xda.KSC5601-1992 (Johab) lead byte 0xda.
KSC5601-1992 (Johab) lead byte 0xdb.KSC5601-1992 (Johab) lead byte 0xdb.KSC5601-1992 (Johab) lead byte 0xdb.KSC5601-1992 (Johab) lead byte 0xdb.
KSC5601-1992 (Johab) lead byte 0xdc.KSC5601-1992 (Johab) lead byte 0xdc.KSC5601-1992 (Johab) lead byte 0xdc.KSC5601-1992 (Johab) lead byte 0xdc.
KSC5601-1992 (Johab) lead byte 0xdd.KSC5601-1992 (Johab) lead byte 0xdd.KSC5601-1992 (Johab) lead byte 0xdd.KSC5601-1992 (Johab) lead byte 0xdd.
KSC5601-1992 (Johab) lead byte 0xde.KSC5601-1992 (Johab) lead byte 0xde.KSC5601-1992 (Johab) lead byte 0xde.KSC5601-1992 (Johab) lead byte 0xde.
KSC5601-1992 (Johab) lead byte 0xdf.KSC5601-1992 (Johab) lead byte 0xdf.KSC5601-1992 (Johab) lead byte 0xdf.KSC5601-1992 (Johab) lead byte 0xdf.
KSC5601-1992 (Johab) lead byte 0xe0.KSC5601-1992 (Johab) lead byte 0xe0.KSC5601-1992 (Johab) lead byte 0xe0.KSC5601-1992 (Johab) lead byte 0xe0.
KSC5601-1992 (Johab) lead byte 0xe1.KSC5601-1992 (Johab) lead byte 0xe1.KSC5601-1992 (Johab) lead byte 0xe1.KSC5601-1992 (Johab) lead byte 0xe1.
KSC5601-1992 (Johab) lead byte 0xe2.KSC5601-1992 (Johab) lead byte 0xe2.KSC5601-1992 (Johab) lead byte 0xe2.KSC5601-1992 (Johab) lead byte 0xe2.
KSC5601-1992 (Johab) lead byte 0xe3.KSC5601-1992 (Johab) lead byte 0xe3.KSC5601-1992 (Johab) lead byte 0xe3.KSC5601-1992 (Johab) lead byte 0xe3.
KSC5601-1992 (Johab) lead byte 0xe4.KSC5601-1992 (Johab) lead byte 0xe4.KSC5601-1992 (Johab) lead byte 0xe4.KSC5601-1992 (Johab) lead byte 0xe4.
KSC5601-1992 (Johab) lead byte 0xe5.KSC5601-1992 (Johab) lead byte 0xe5.KSC5601-1992 (Johab) lead byte 0xe5.KSC5601-1992 (Johab) lead byte 0xe5.
KSC5601-1992 (Johab) lead byte 0xe6.KSC5601-1992 (Johab) lead byte 0xe6.KSC5601-1992 (Johab) lead byte 0xe6.KSC5601-1992 (Johab) lead byte 0xe6.
KSC5601-1992 (Johab) lead byte 0xe7.KSC5601-1992 (Johab) lead byte 0xe7.KSC5601-1992 (Johab) lead byte 0xe7.KSC5601-1992 (Johab) lead byte 0xe7.
KSC5601-1992 (Johab) lead byte 0xe8.KSC5601-1992 (Johab) lead byte 0xe8.KSC5601-1992 (Johab) lead byte 0xe8.KSC5601-1992 (Johab) lead byte 0xe8.
KSC5601-1992 (Johab) lead byte 0xe9.KSC5601-1992 (Johab) lead byte 0xe9.KSC5601-1992 (Johab) lead byte 0xe9.KSC5601-1992 (Johab) lead byte 0xe9.
KSC5601-1992 (Johab) lead byte 0xea.KSC5601-1992 (Johab) lead byte 0xea.KSC5601-1992 (Johab) lead byte 0xea.KSC5601-1992 (Johab) lead byte 0xea.
KSC5601-1992 (Johab) lead byte 0xeb.KSC5601-1992 (Johab) lead byte 0xeb.KSC5601-1992 (Johab) lead byte 0xeb.KSC5601-1992 (Johab) lead byte 0xeb.
KSC5601-1992 (Johab) lead byte 0xec.KSC5601-1992 (Johab) lead byte 0xec.KSC5601-1992 (Johab) lead byte 0xec.KSC5601-1992 (Johab) lead byte 0xec.
KSC5601-1992 (Johab) lead byte 0xed.KSC5601-1992 (Johab) lead byte 0xed.KSC5601-1992 (Johab) lead byte 0xed.KSC5601-1992 (Johab) lead byte 0xed.
KSC5601-1992 (Johab) lead byte 0xee.KSC5601-1992 (Johab) lead byte 0xee.KSC5601-1992 (Johab) lead byte 0xee.KSC5601-1992 (Johab) lead byte 0xee.
KSC5601-1992 (Johab) lead byte 0xef.KSC5601-1992 (Johab) lead byte 0xef.KSC5601-1992 (Johab) lead byte 0xef.KSC5601-1992 (Johab) lead byte 0xef.
KSC5601-1992 (Johab) lead byte 0xf0.KSC5601-1992 (Johab) lead byte 0xf0.KSC5601-1992 (Johab) lead byte 0xf0.KSC5601-1992 (Johab) lead byte 0xf0.
KSC5601-1992 (Johab) lead byte 0xf1.KSC5601-1992 (Johab) lead byte 0xf1.KSC5601-1992 (Johab) lead byte 0xf1.KSC5601-1992 (Johab) lead byte 0xf1.
KSC5601-1992 (Johab) lead byte 0xf2.KSC5601-1992 (Johab) lead byte 0xf2.KSC5601-1992 (Johab) lead byte 0xf2.KSC5601-1992 (Johab) lead byte 0xf2.
KSC5601-1992 (Johab) lead byte 0xf3.KSC5601-1992 (Johab) lead byte 0xf3.KSC5601-1992 (Johab) lead byte 0xf3.KSC5601-1992 (Johab) lead byte 0xf3.
KSC5601-1992 (Johab) lead byte 0xf4.KSC5601-1992 (Johab) lead byte 0xf4.KSC5601-1992 (Johab) lead byte 0xf4.KSC5601-1992 (Johab) lead byte 0xf4.
KSC5601-1992 (Johab) lead byte 0xf5.KSC5601-1992 (Johab) lead byte 0xf5.KSC5601-1992 (Johab) lead byte 0xf5.KSC5601-1992 (Johab) lead byte 0xf5.
KSC5601-1992 (Johab) lead byte 0xf6.KSC5601-1992 (Johab) lead byte 0xf6.KSC5601-1992 (Johab) lead byte 0xf6.KSC5601-1992 (Johab) lead byte 0xf6.
KSC5601-1992 (Johab) lead byte 0xf7.KSC5601-1992 (Johab) lead byte 0xf7.KSC5601-1992 (Johab) lead byte 0xf7.KSC5601-1992 (Johab) lead byte 0xf7.
KSC5601-1992 (Johab) lead byte 0xf8.KSC5601-1992 (Johab) lead byte 0xf8.KSC5601-1992 (Johab) lead byte 0xf8.KSC5601-1992 (Johab) lead byte 0xf8.
KSC5601-1992 (Johab) lead byte 0xf9.KSC5601-1992 (Johab) lead byte 0xf9.KSC5601-1992 (Johab) lead byte 0xf9.KSC5601-1992 (Johab) lead byte 0xf9.
KSC5601-1992 (Johab) lead byte 0xfa.KSC5601-1992 (Johab) lead byte 0xfa.KSC5601-1992 (Johab) lead byte 0xfa.KSC5601-1992 (Johab) lead byte 0xfa.
KSC5601-1992 (Johab) lead byte 0xfb.KSC5601-1992 (Johab) lead byte 0xfb.KSC5601-1992 (Johab) lead byte 0xfb.KSC5601-1992 (Johab) lead byte 0xfb.
KSC5601-1992 (Johab) lead byte 0xfc.KSC5601-1992 (Johab) lead byte 0xfc.KSC5601-1992 (Johab) lead byte 0xfc.KSC5601-1992 (Johab) lead byte 0xfc.
KSC5601-1992 (Johab) lead byte 0xfd.KSC5601-1992 (Johab) lead byte 0xfd.KSC5601-1992 (Johab) lead byte 0xfd.KSC5601-1992 (Johab) lead byte 0xfd.
Kana subrangeKana subrangeKana subrangeKana subrange
Kanji lead byte 0x81.Kanji lead byte 0x81.Kanji lead byte 0x81.Kanji lead byte 0x81.
Kanji lead byte 0x82.Kanji lead byte 0x82.Kanji lead byte 0x82.Kanji lead byte 0x82.
Kanji lead byte 0x83.Kanji lead byte 0x83.Kanji lead byte 0x83.Kanji lead byte 0x83.
Kanji lead byte 0x84.Kanji lead byte 0x84.Kanji lead byte 0x84.Kanji lead byte 0x84.
Kanji lead byte 0x85.Kanji lead byte 0x85.Kanji lead byte 0x85.Kanji lead byte 0x85.
Kanji lead byte 0x86.Kanji lead byte 0x86.Kanji lead byte 0x86.Kanji lead byte 0x86.
Kanji lead byte 0x87.Kanji lead byte 0x87.Kanji lead byte 0x87.Kanji lead byte 0x87.
Kanji lead byte 0x88.Kanji lead byte 0x88.Kanji lead byte 0x88.Kanji lead byte 0x88.
Kanji lead byte 0x89.Kanji lead byte 0x89.Kanji lead byte 0x89.Kanji lead byte 0x89.
Kanji lead byte 0x8a.Kanji lead byte 0x8a.Kanji lead byte 0x8a.Kanji lead byte 0x8a.
Kanji lead byte 0x8b.Kanji lead byte 0x8b.Kanji lead byte 0x8b.Kanji lead byte 0x8b.
Kanji lead byte 0x8c.Kanji lead byte 0x8c.Kanji lead byte 0x8c.Kanji lead byte 0x8c.
Kanji lead byte 0x8d.Kanji lead byte 0x8d.Kanji lead byte 0x8d.Kanji lead byte 0x8d.
Kanji lead byte 0x8e.Kanji lead byte 0x8e.Kanji lead byte 0x8e.Kanji lead byte 0x8e.
Kanji lead byte 0x8f.Kanji lead byte 0x8f.Kanji lead byte 0x8f.Kanji lead byte 0x8f.
Kanji lead byte 0x90.Kanji lead byte 0x90.Kanji lead byte 0x90.Kanji lead byte 0x90.
Kanji lead byte 0x91.Kanji lead byte 0x91.Kanji lead byte 0x91.Kanji lead byte 0x91.
Kanji lead byte 0x92.Kanji lead byte 0x92.Kanji lead byte 0x92.Kanji lead byte 0x92.
Kanji lead byte 0x93.Kanji lead byte 0x93.Kanji lead byte 0x93.Kanji lead byte 0x93.
Kanji lead byte 0x94.Kanji lead byte 0x94.Kanji lead byte 0x94.Kanji lead byte 0x94.
Kanji lead byte 0x95.Kanji lead byte 0x95.Kanji lead byte 0x95.Kanji lead byte 0x95.
Kanji lead byte 0x96.Kanji lead byte 0x96.Kanji lead byte 0x96.Kanji lead byte 0x96.
Kanji lead byte 0x97.Kanji lead byte 0x97.Kanji lead byte 0x97.Kanji lead byte 0x97.
Kanji lead byte 0x98.Kanji lead byte 0x98.Kanji lead byte 0x98.Kanji lead byte 0x98.
Kanji lead byte 0x99.Kanji lead byte 0x99.Kanji lead byte 0x99.Kanji lead byte 0x99.
Kanji lead byte 0x9a.Kanji lead byte 0x9a.Kanji lead byte 0x9a.Kanji lead byte 0x9a.
Kanji lead byte 0x9b.Kanji lead byte 0x9b.Kanji lead byte 0x9b.Kanji lead byte 0x9b.
Kanji lead byte 0x9c.Kanji lead byte 0x9c.Kanji lead byte 0x9c.Kanji lead byte 0x9c.
Kanji lead byte 0x9d.Kanji lead byte 0x9d.Kanji lead byte 0x9d.Kanji lead byte 0x9d.
Kanji lead byte 0x9e.Kanji lead byte 0x9e.Kanji lead byte 0x9e.Kanji lead byte 0x9e.
Kanji lead byte 0x9f.Kanji lead byte 0x9f.Kanji lead byte 0x9f.Kanji lead byte 0x9f.
Kanji lead byte 0xe0.Kanji lead byte 0xe0.Kanji lead byte 0xe0.Kanji lead byte 0xe0.
Kanji lead byte 0xe1.Kanji lead byte 0xe1.Kanji lead byte 0xe1.Kanji lead byte 0xe1.
Kanji lead byte 0xe2.Kanji lead byte 0xe2.Kanji lead byte 0xe2.Kanji lead byte 0xe2.
Kanji lead byte 0xe3.Kanji lead byte 0xe3.Kanji lead byte 0xe3.Kanji lead byte 0xe3.
Kanji lead byte 0xe4.Kanji lead byte 0xe4.Kanji lead byte 0xe4.Kanji lead byte 0xe4.
Kanji lead byte 0xe5.Kanji lead byte 0xe5.Kanji lead byte 0xe5.Kanji lead byte 0xe5.
Kanji lead byte 0xe6.Kanji lead byte 0xe6.Kanji lead byte 0xe6.Kanji lead byte 0xe6.
Kanji lead byte 0xe7.Kanji lead byte 0xe7.Kanji lead byte 0xe7.Kanji lead byte 0xe7.
Kanji lead byte 0xe8.Kanji lead byte 0xe8.Kanji lead byte 0xe8.Kanji lead byte 0xe8.
Kanji lead byte 0xe9.Kanji lead byte 0xe9.Kanji lead byte 0xe9.Kanji lead byte 0xe9.
Kanji lead byte 0xea.Kanji lead byte 0xea.Kanji lead byte 0xea.Kanji lead byte 0xea.
Kanji lead byte 0xeb.Kanji lead byte 0xeb.Kanji lead byte 0xeb.Kanji lead byte 0xeb.
Kanji lead byte 0xec.Kanji lead byte 0xec.Kanji lead byte 0xec.Kanji lead byte 0xec.
Kanji lead byte 0xed.Kanji lead byte 0xed.Kanji lead byte 0xed.Kanji lead byte 0xed.
Kanji lead byte 0xee.Kanji lead byte 0xee.Kanji lead byte 0xee.Kanji lead byte 0xee.
Kanji lead byte 0xef.Kanji lead byte 0xef.Kanji lead byte 0xef.Kanji lead byte 0xef.
Kanji lead byte 0xf0.Kanji lead byte 0xf0.Kanji lead byte 0xf0.Kanji lead byte 0xf0.
Kanji lead byte 0xf1.Kanji lead byte 0xf1.Kanji lead byte 0xf1.Kanji lead byte 0xf1.
Kanji lead byte 0xf2.Kanji lead byte 0xf2.Kanji lead byte 0xf2.Kanji lead byte 0xf2.
Kanji lead byte 0xf3.Kanji lead byte 0xf3.Kanji lead byte 0xf3.Kanji lead byte 0xf3.
Kanji lead byte 0xf4.Kanji lead byte 0xf4.Kanji lead byte 0xf4.Kanji lead byte 0xf4.
Kanji lead byte 0xf5.Kanji lead byte 0xf5.Kanji lead byte 0xf5.Kanji lead byte 0xf5.
Kanji lead byte 0xf6.Kanji lead byte 0xf6.Kanji lead byte 0xf6.Kanji lead byte 0xf6.
Kanji lead byte 0xf7.Kanji lead byte 0xf7.Kanji lead byte 0xf7.Kanji lead byte 0xf7.
Kanji lead byte 0xf8.Kanji lead byte 0xf8.Kanji lead byte 0xf8.Kanji lead byte 0xf8.
Kanji lead byte 0xf9.Kanji lead byte 0xf9.Kanji lead byte 0xf9.Kanji lead byte 0xf9.
Kanji lead byte 0xfa.Kanji lead byte 0xfa.Kanji lead byte 0xfa.Kanji lead byte 0xfa.
Kanji lead byte 0xfb.Kanji lead byte 0xfb.Kanji lead byte 0xfb.Kanji lead byte 0xfb.
Kanji lead byte 0xfc.Kanji lead byte 0xfc.Kanji lead byte 0xfc.Kanji lead byte 0xfc.
KeyKeyKeyKey
Keyed ListsKeyed ListsKeyed ListsKeyed Lists
LALR ClosureLALR ClosureLALR ClosureLALR Closure
LALR Parser Table generatorLALR Parser Table generatorLALR Parser Table generatorLALR Parser Table generator
LALR(1) Parser table generatorLALR(1) Parser table generatorLALR(1) Parser table generatorLALR(1) Parser table generator
LR parser engineLR parser engineLR parser engineLR parser engine
LaTeX WeaverLaTeX WeaverLaTeX WeaverLaTeX Weaver
Lambda ClassLambda ClassLambda ClassLambda Class
Language TranslationLanguage TranslationLanguage TranslationLanguage Translation
LastÚltimoLastLast
Latex PreambleLatex PreambleLatex PreambleLatex Preamble
Latex, Plain text and flat Html WeaversLatex, Plain text and flat Html WeaversLatex, Plain text and flat Html WeaversLatex, Plain text and flat Html Weavers
Lexical ScopingLexical ScopingLexical ScopingLexical Scoping
Line and Page breaksLine and Page breaksLine and Page breaksLine and Page breaks
Listing of iscr.pak sourceListing of iscr.pak sourceListing of iscr.pak sourceListing of iscr.pak source
ListsListsListsLists
Llambda WeaverLlambda WeaverLlambda WeaverLlambda Weaver
Long Script testLong Script testLong Script testLong Script test
Long script sectionsLong script sectionsLong script sectionsLong script sections
Lout Prolog and EpilogLout Prolog and EpilogLout Prolog and EpilogLout Prolog and Epilog
Lout WeaverLout WeaverLout WeaverLout Weaver
Low Surrogates dc00-dcffLow Surrogates dc00-dcffLow Surrogates dc00-dcffLow Surrogates dc00-dcff
Low Surrogates dd00-ddffLow Surrogates dd00-ddffLow Surrogates dd00-ddffLow Surrogates dd00-ddff
Low Surrogates de00-deffLow Surrogates de00-deffLow Surrogates de00-deffLow Surrogates de00-deff
Low Surrogates df00-dfffLow Surrogates df00-dfffLow Surrogates df00-dfffLow Surrogates df00-dfff
MSIE DOM ECMAScriptMSIE DOM ECMAScriptMSIE DOM ECMAScriptMSIE DOM ECMAScript
Mac: write a launch scriptMac: write a launch scriptMac: write a launch scriptMac: write a launch script
Mac_CyrillicMac_CyrillicMac_CyrillicMac_Cyrillic
Mac_GreekMac_GreekMac_GreekMac_Greek
Mac_IcelandMac_IcelandMac_IcelandMac_Iceland
Mac_Latin2Mac_Latin2Mac_Latin2Mac_Latin2
Mac_RomanMac_RomanMac_RomanMac_Roman
Mac_TurkishMac_TurkishMac_TurkishMac_Turkish
Main RoutineMain RoutineMain RoutineMain Routine
ManagementManagementManagementManagement
Managing the tangler stackManaging the tangler stackManaging the tangler stackManaging the tangler stack
Mandatory FramesMandatory FramesMandatory FramesMandatory Frames
Marc-Andre's Generic header for mx extensionsMarc-Andre's Generic header for mx extensionsMarc-Andre's Generic header for mx extensionsMarc-Andre's Generic header for mx extensions
Marc-Andre's Standard MacrosMarc-Andre's Standard MacrosMarc-Andre's Standard MacrosMarc-Andre's Standard Macros
Markup filtering weaverMarkup filtering weaverMarkup filtering weaverMarkup filtering weaver
Master FrameMaster FrameMaster FrameMaster Frame
Match Processing functionsMatch Processing functionsMatch Processing functionsMatch Processing functions
Measuring Change ImpactMeasuring Change ImpactMeasuring Change ImpactMeasuring Change Impact
Memory DriverMemory DriverMemory DriverMemory Driver
Microformatting shortcutsMicroformatting shortcutsMicroformatting shortcutsMicroformatting shortcuts
Misc BugsMisc BugsMisc BugsMisc Bugs
Misc: move theseMisc: move theseMisc: move theseMisc: move these
MiscellaneousMiscellaneousMiscellaneousMiscellaneous
Module getoptionsModule getoptionsModule getoptionsModule getoptions
MonoidsMonoidsMonoidsMonoids
Multi-Line Python ScriptMulti-Line Python ScriptMulti-Line Python ScriptMulti-Line Python Script
Multiple DocumentsMultiple DocumentsMultiple DocumentsMultiple Documents
Multiple Human LanguagesMultiple Human LanguagesMultiple Human LanguagesMultiple Human Languages
Multiple TypesettersMultiple TypesettersMultiple TypesettersMultiple Typesetters
Multiplex WeaverMultiplex WeaverMultiplex WeaverMultiplex Weaver
MutatorsMutatorsMutatorsMutators
My DocumentMy DocumentMy DocumentMy Document
My ModuleMy ModuleMy ModuleMy Module
NT IssuesNT IssuesNT IssuesNT Issues
Named File Sink NamesNamed File Sink NamesNamed File Sink NamesNamed File Sink Names
Named File Source NamesNamed File Source NamesNamed File Source NamesNamed File Source Names
Nestable ListsNestable ListsNestable ListsNestable Lists
New featuresNew featuresNew featuresNew features
New in 1a5New in 1a5New in 1a5New in 1a5
NextSiguienteFolgendeSeguente
NotGivenNotGivenNotGivenNotGiven
NoticesNoticesNoticesNotices
Null SinkNull SinkNull SinkNull Sink
Null TanglerNull TanglerNull TanglerNull Tangler
Numbered ListsNumbered ListsNumbered ListsNumbered Lists
OK, so how do I put HTML into a document?OK, so how do I put HTML into a document?OK, so how do I put HTML into a document?OK, so how do I put HTML into a document?
Object tracingObject tracingObject tracingObject tracing
Omega Translation ProcessOmega Translation ProcessOmega Translation ProcessOmega Translation Process
OmissionsOmissionsOmissionsOmissions
Option helpOption helpOption helpOption help
Ordinary TextOrdinary TextOrdinary TextOrdinary Text
Original Source ReferencesOriginal Source ReferencesOriginal Source ReferencesOriginal Source References
OtherOtherOtherOther
Output AdapterOutput AdapterOutput AdapterOutput Adapter
PC_Cp437PC_Cp437PC_Cp437PC_Cp437
PC_Cp737PC_Cp737PC_Cp737PC_Cp737
PC_Cp775PC_Cp775PC_Cp775PC_Cp775
PC_Cp850PC_Cp850PC_Cp850PC_Cp850
PC_Cp852PC_Cp852PC_Cp852PC_Cp852
PC_Cp855PC_Cp855PC_Cp855PC_Cp855
PC_Cp857PC_Cp857PC_Cp857PC_Cp857
PC_Cp860PC_Cp860PC_Cp860PC_Cp860
PC_Cp861PC_Cp861PC_Cp861PC_Cp861
PC_Cp862PC_Cp862PC_Cp862PC_Cp862
PC_Cp863PC_Cp863PC_Cp863PC_Cp863
PC_Cp864PC_Cp864PC_Cp864PC_Cp864
PC_Cp865PC_Cp865PC_Cp865PC_Cp865
PC_Cp866PC_Cp866PC_Cp866PC_Cp866
PC_Cp869PC_Cp869PC_Cp869PC_Cp869
PC_Cp874PC_Cp874PC_Cp874PC_Cp874
ParagraphsParagraphsParagraphsParagraphs
ParserParserParserParser
Parser functionsParser functionsParser functionsParser functions
ParsersParsersParsersParsers
ParsingParsingParsingParsing
Parsing for embedded documentationParsing for embedded documentationParsing for embedded documentationParsing for embedded documentation
Parsing for reference tablesParsing for reference tablesParsing for reference tablesParsing for reference tables
Partially Parsable LanguagesPartially Parsable LanguagesPartially Parsable LanguagesPartially Parsable Languages
PassesPassesPassesPasses
Paths on graphsPaths on graphsPaths on graphsPaths on graphs
Perl DOCPerl DOCPerl DOCPerl DOC
Perl TanglerPerl TanglerPerl TanglerPerl Tangler
Perl hates @Perl hates @Perl hates @Perl hates @
PerlPOD supportPerlPOD supportPerlPOD supportPerlPOD support
Persistent Storage SinkPersistent Storage SinkPersistent Storage SinkPersistent Storage Sink
PhobosPhobosPhobosPhobos
Phrase translation TestPhrase translation TestPhrase translation TestPhrase translation Test
Plain text weaverPlain text weaverPlain text weaverPlain text weaver
Platform independent filenamesPlatform independent filenamesPlatform independent filenamesPlatform independent filenames
Posix ImplementationPosix ImplementationPosix ImplementationPosix Implementation
Post user methodsPost user methodsPost user methodsPost user methods
PredicatesPredicatesPredicatesPredicates
Prepare Text and Code for LoutPrepare Text and Code for LoutPrepare Text and Code for LoutPrepare Text and Code for Lout
PrevPrevioVorigePrev
Print diff tablePrint diff tablePrint diff tablePrint diff table
Process file dataProcess file dataProcess file dataProcess file data
ProcessorsProcessorsProcessorsProcessors
ProductProductProductProduct
Programming metricsProgramming metricsProgramming metricsProgramming metrics
Python Doc stringsPython Doc stringsPython Doc stringsPython Doc strings
Python ScriptingPython ScriptingPython ScriptingPython Scripting
Python TanglerPython TanglerPython TanglerPython Tangler
Python TestPython TestPython TestPython Test
Python TokeniserPython TokeniserPython TokeniserPython Tokeniser
Python comment tanglerPython comment tanglerPython comment tanglerPython comment tangler
Python hostingPython hostingPython hostingPython hosting
Questions and AnswersQuestions and AnswersQuestions and AnswersQuestions and Answers
Quick Test of TablesQuick Test of TablesQuick Test of TablesQuick Test of Tables
Range 0000-00ffRange 0000-00ffRange 0000-00ffRange 0000-00ff
Range 0100-01ffRange 0100-01ffRange 0100-01ffRange 0100-01ff
Range 0200-02ffRange 0200-02ffRange 0200-02ffRange 0200-02ff
Range 0300-03ffRange 0300-03ffRange 0300-03ffRange 0300-03ff
Range 0400-04ffRange 0400-04ffRange 0400-04ffRange 0400-04ff
Range 0500-05ffRange 0500-05ffRange 0500-05ffRange 0500-05ff
Range 0600-06ffRange 0600-06ffRange 0600-06ffRange 0600-06ff
Range 0700-07ffRange 0700-07ffRange 0700-07ffRange 0700-07ff
Range 0800-08ffRange 0800-08ffRange 0800-08ffRange 0800-08ff
Range 0900-09ffRange 0900-09ffRange 0900-09ffRange 0900-09ff
Range 0a00-0affRange 0a00-0affRange 0a00-0affRange 0a00-0aff
Range 0b00-0bffRange 0b00-0bffRange 0b00-0bffRange 0b00-0bff
Range 0c00-0cffRange 0c00-0cffRange 0c00-0cffRange 0c00-0cff
Range 0d00-0dffRange 0d00-0dffRange 0d00-0dffRange 0d00-0dff
Range 0e00-0effRange 0e00-0effRange 0e00-0effRange 0e00-0eff
Range 0f00-0fffRange 0f00-0fffRange 0f00-0fffRange 0f00-0fff
Range 1000-10ffRange 1000-10ffRange 1000-10ffRange 1000-10ff
Range 1100-11ffRange 1100-11ffRange 1100-11ffRange 1100-11ff
Range 1200-12ffRange 1200-12ffRange 1200-12ffRange 1200-12ff
Range 1300-13ffRange 1300-13ffRange 1300-13ffRange 1300-13ff
Range 1400-14ffRange 1400-14ffRange 1400-14ffRange 1400-14ff
Range 1500-15ffRange 1500-15ffRange 1500-15ffRange 1500-15ff
Range 1600-16ffRange 1600-16ffRange 1600-16ffRange 1600-16ff
Range 1700-17ffRange 1700-17ffRange 1700-17ffRange 1700-17ff
Range 1800-18ffRange 1800-18ffRange 1800-18ffRange 1800-18ff
Range 1900-19ffRange 1900-19ffRange 1900-19ffRange 1900-19ff
Range 1a00-1affRange 1a00-1affRange 1a00-1affRange 1a00-1aff
Range 1b00-1bffRange 1b00-1bffRange 1b00-1bffRange 1b00-1bff
Range 1c00-1cffRange 1c00-1cffRange 1c00-1cffRange 1c00-1cff
Range 1d00-1dffRange 1d00-1dffRange 1d00-1dffRange 1d00-1dff
Range 1e00-1effRange 1e00-1effRange 1e00-1effRange 1e00-1eff
Range 1f00-1fffRange 1f00-1fffRange 1f00-1fffRange 1f00-1fff
Range 2000-20ffRange 2000-20ffRange 2000-20ffRange 2000-20ff
Range 2100-21ffRange 2100-21ffRange 2100-21ffRange 2100-21ff
Range 2200-22ffRange 2200-22ffRange 2200-22ffRange 2200-22ff
Range 2300-23ffRange 2300-23ffRange 2300-23ffRange 2300-23ff
Range 2400-24ffRange 2400-24ffRange 2400-24ffRange 2400-24ff
Range 2500-25ffRange 2500-25ffRange 2500-25ffRange 2500-25ff
Range 2600-26ffRange 2600-26ffRange 2600-26ffRange 2600-26ff
Range 2700-27ffRange 2700-27ffRange 2700-27ffRange 2700-27ff
Range 2800-28ffRange 2800-28ffRange 2800-28ffRange 2800-28ff
Range 2900-29ffRange 2900-29ffRange 2900-29ffRange 2900-29ff
Range 2a00-2affRange 2a00-2affRange 2a00-2affRange 2a00-2aff
Range 2b00-2bffRange 2b00-2bffRange 2b00-2bffRange 2b00-2bff
Range 2c00-2cffRange 2c00-2cffRange 2c00-2cffRange 2c00-2cff
Range 2d00-2dffRange 2d00-2dffRange 2d00-2dffRange 2d00-2dff
Range 2e00-2effRange 2e00-2effRange 2e00-2effRange 2e00-2eff
Range 2f00-2fffRange 2f00-2fffRange 2f00-2fffRange 2f00-2fff
Range 3000-30ffRange 3000-30ffRange 3000-30ffRange 3000-30ff
Range 3100-31ffRange 3100-31ffRange 3100-31ffRange 3100-31ff
Range 3200-32ffRange 3200-32ffRange 3200-32ffRange 3200-32ff
Range 3300-33ffRange 3300-33ffRange 3300-33ffRange 3300-33ff
Range 3400-34ffRange 3400-34ffRange 3400-34ffRange 3400-34ff
Range 3500-35ffRange 3500-35ffRange 3500-35ffRange 3500-35ff
Range 3600-36ffRange 3600-36ffRange 3600-36ffRange 3600-36ff
Range 3700-37ffRange 3700-37ffRange 3700-37ffRange 3700-37ff
Range 3800-38ffRange 3800-38ffRange 3800-38ffRange 3800-38ff
Range 3900-39ffRange 3900-39ffRange 3900-39ffRange 3900-39ff
Range 3a00-3affRange 3a00-3affRange 3a00-3affRange 3a00-3aff
Range 3b00-3bffRange 3b00-3bffRange 3b00-3bffRange 3b00-3bff
Range 3c00-3cffRange 3c00-3cffRange 3c00-3cffRange 3c00-3cff
Range 3d00-3dffRange 3d00-3dffRange 3d00-3dffRange 3d00-3dff
Range 3e00-3effRange 3e00-3effRange 3e00-3effRange 3e00-3eff
Range 3f00-3fffRange 3f00-3fffRange 3f00-3fffRange 3f00-3fff
Range 4000-40ffRange 4000-40ffRange 4000-40ffRange 4000-40ff
Range 4100-41ffRange 4100-41ffRange 4100-41ffRange 4100-41ff
Range 4200-42ffRange 4200-42ffRange 4200-42ffRange 4200-42ff
Range 4300-43ffRange 4300-43ffRange 4300-43ffRange 4300-43ff
Range 4400-44ffRange 4400-44ffRange 4400-44ffRange 4400-44ff
Range 4500-45ffRange 4500-45ffRange 4500-45ffRange 4500-45ff
Range 4600-46ffRange 4600-46ffRange 4600-46ffRange 4600-46ff
Range 4700-47ffRange 4700-47ffRange 4700-47ffRange 4700-47ff
Range 4800-48ffRange 4800-48ffRange 4800-48ffRange 4800-48ff
Range 4900-49ffRange 4900-49ffRange 4900-49ffRange 4900-49ff
Range 4a00-4affRange 4a00-4affRange 4a00-4affRange 4a00-4aff
Range 4b00-4bffRange 4b00-4bffRange 4b00-4bffRange 4b00-4bff
Range 4c00-4cffRange 4c00-4cffRange 4c00-4cffRange 4c00-4cff
Range 4d00-4dffRange 4d00-4dffRange 4d00-4dffRange 4d00-4dff
Range 4e00-4effRange 4e00-4effRange 4e00-4effRange 4e00-4eff
Range 4f00-4fffRange 4f00-4fffRange 4f00-4fffRange 4f00-4fff
Range 5000-50ffRange 5000-50ffRange 5000-50ffRange 5000-50ff
Range 5100-51ffRange 5100-51ffRange 5100-51ffRange 5100-51ff
Range 5200-52ffRange 5200-52ffRange 5200-52ffRange 5200-52ff
Range 5300-53ffRange 5300-53ffRange 5300-53ffRange 5300-53ff
Range 5400-54ffRange 5400-54ffRange 5400-54ffRange 5400-54ff
Range 5500-55ffRange 5500-55ffRange 5500-55ffRange 5500-55ff
Range 5600-56ffRange 5600-56ffRange 5600-56ffRange 5600-56ff
Range 5700-57ffRange 5700-57ffRange 5700-57ffRange 5700-57ff
Range 5800-58ffRange 5800-58ffRange 5800-58ffRange 5800-58ff
Range 5900-59ffRange 5900-59ffRange 5900-59ffRange 5900-59ff
Range 5a00-5affRange 5a00-5affRange 5a00-5affRange 5a00-5aff
Range 5b00-5bffRange 5b00-5bffRange 5b00-5bffRange 5b00-5bff
Range 5c00-5cffRange 5c00-5cffRange 5c00-5cffRange 5c00-5cff
Range 5d00-5dffRange 5d00-5dffRange 5d00-5dffRange 5d00-5dff
Range 5e00-5effRange 5e00-5effRange 5e00-5effRange 5e00-5eff
Range 5f00-5fffRange 5f00-5fffRange 5f00-5fffRange 5f00-5fff
Range 6000-60ffRange 6000-60ffRange 6000-60ffRange 6000-60ff
Range 6100-61ffRange 6100-61ffRange 6100-61ffRange 6100-61ff
Range 6200-62ffRange 6200-62ffRange 6200-62ffRange 6200-62ff
Range 6300-63ffRange 6300-63ffRange 6300-63ffRange 6300-63ff
Range 6400-64ffRange 6400-64ffRange 6400-64ffRange 6400-64ff
Range 6500-65ffRange 6500-65ffRange 6500-65ffRange 6500-65ff
Range 6600-66ffRange 6600-66ffRange 6600-66ffRange 6600-66ff
Range 6700-67ffRange 6700-67ffRange 6700-67ffRange 6700-67ff
Range 6800-68ffRange 6800-68ffRange 6800-68ffRange 6800-68ff
Range 6900-69ffRange 6900-69ffRange 6900-69ffRange 6900-69ff
Range 6a00-6affRange 6a00-6affRange 6a00-6affRange 6a00-6aff
Range 6b00-6bffRange 6b00-6bffRange 6b00-6bffRange 6b00-6bff
Range 6c00-6cffRange 6c00-6cffRange 6c00-6cffRange 6c00-6cff
Range 6d00-6dffRange 6d00-6dffRange 6d00-6dffRange 6d00-6dff
Range 6e00-6effRange 6e00-6effRange 6e00-6effRange 6e00-6eff
Range 6f00-6fffRange 6f00-6fffRange 6f00-6fffRange 6f00-6fff
Range 7000-70ffRange 7000-70ffRange 7000-70ffRange 7000-70ff
Range 7100-71ffRange 7100-71ffRange 7100-71ffRange 7100-71ff
Range 7200-72ffRange 7200-72ffRange 7200-72ffRange 7200-72ff
Range 7300-73ffRange 7300-73ffRange 7300-73ffRange 7300-73ff
Range 7400-74ffRange 7400-74ffRange 7400-74ffRange 7400-74ff
Range 7500-75ffRange 7500-75ffRange 7500-75ffRange 7500-75ff
Range 7600-76ffRange 7600-76ffRange 7600-76ffRange 7600-76ff
Range 7700-77ffRange 7700-77ffRange 7700-77ffRange 7700-77ff
Range 7800-78ffRange 7800-78ffRange 7800-78ffRange 7800-78ff
Range 7900-79ffRange 7900-79ffRange 7900-79ffRange 7900-79ff
Range 7a00-7affRange 7a00-7affRange 7a00-7affRange 7a00-7aff
Range 7b00-7bffRange 7b00-7bffRange 7b00-7bffRange 7b00-7bff
Range 7c00-7cffRange 7c00-7cffRange 7c00-7cffRange 7c00-7cff
Range 7d00-7dffRange 7d00-7dffRange 7d00-7dffRange 7d00-7dff
Range 7e00-7effRange 7e00-7effRange 7e00-7effRange 7e00-7eff
Range 7f00-7fffRange 7f00-7fffRange 7f00-7fffRange 7f00-7fff
Range 8000-80ffRange 8000-80ffRange 8000-80ffRange 8000-80ff
Range 8100-81ffRange 8100-81ffRange 8100-81ffRange 8100-81ff
Range 8200-82ffRange 8200-82ffRange 8200-82ffRange 8200-82ff
Range 8300-83ffRange 8300-83ffRange 8300-83ffRange 8300-83ff
Range 8400-84ffRange 8400-84ffRange 8400-84ffRange 8400-84ff
Range 8500-85ffRange 8500-85ffRange 8500-85ffRange 8500-85ff
Range 8600-86ffRange 8600-86ffRange 8600-86ffRange 8600-86ff
Range 8700-87ffRange 8700-87ffRange 8700-87ffRange 8700-87ff
Range 8800-88ffRange 8800-88ffRange 8800-88ffRange 8800-88ff
Range 8900-89ffRange 8900-89ffRange 8900-89ffRange 8900-89ff
Range 8a00-8affRange 8a00-8affRange 8a00-8affRange 8a00-8aff
Range 8b00-8bffRange 8b00-8bffRange 8b00-8bffRange 8b00-8bff
Range 8c00-8cffRange 8c00-8cffRange 8c00-8cffRange 8c00-8cff
Range 8d00-8dffRange 8d00-8dffRange 8d00-8dffRange 8d00-8dff
Range 8e00-8effRange 8e00-8effRange 8e00-8effRange 8e00-8eff
Range 8f00-8fffRange 8f00-8fffRange 8f00-8fffRange 8f00-8fff
Range 9000-90ffRange 9000-90ffRange 9000-90ffRange 9000-90ff
Range 9100-91ffRange 9100-91ffRange 9100-91ffRange 9100-91ff
Range 9200-92ffRange 9200-92ffRange 9200-92ffRange 9200-92ff
Range 9300-93ffRange 9300-93ffRange 9300-93ffRange 9300-93ff
Range 9400-94ffRange 9400-94ffRange 9400-94ffRange 9400-94ff
Range 9500-95ffRange 9500-95ffRange 9500-95ffRange 9500-95ff
Range 9600-96ffRange 9600-96ffRange 9600-96ffRange 9600-96ff
Range 9700-97ffRange 9700-97ffRange 9700-97ffRange 9700-97ff
Range 9800-98ffRange 9800-98ffRange 9800-98ffRange 9800-98ff
Range 9900-99ffRange 9900-99ffRange 9900-99ffRange 9900-99ff
Range 9a00-9affRange 9a00-9affRange 9a00-9affRange 9a00-9aff
Range 9b00-9bffRange 9b00-9bffRange 9b00-9bffRange 9b00-9bff
Range 9c00-9cffRange 9c00-9cffRange 9c00-9cffRange 9c00-9cff
Range 9d00-9dffRange 9d00-9dffRange 9d00-9dffRange 9d00-9dff
Range 9e00-9effRange 9e00-9effRange 9e00-9effRange 9e00-9eff
Range 9f00-9fffRange 9f00-9fffRange 9f00-9fffRange 9f00-9fff
Range a000-a0ffRange a000-a0ffRange a000-a0ffRange a000-a0ff
Range a100-a1ffRange a100-a1ffRange a100-a1ffRange a100-a1ff
Range a200-a2ffRange a200-a2ffRange a200-a2ffRange a200-a2ff
Range a300-a3ffRange a300-a3ffRange a300-a3ffRange a300-a3ff
Range a400-a4ffRange a400-a4ffRange a400-a4ffRange a400-a4ff
Range a500-a5ffRange a500-a5ffRange a500-a5ffRange a500-a5ff
Range a600-a6ffRange a600-a6ffRange a600-a6ffRange a600-a6ff
Range a700-a7ffRange a700-a7ffRange a700-a7ffRange a700-a7ff
Range a800-a8ffRange a800-a8ffRange a800-a8ffRange a800-a8ff
Range a900-a9ffRange a900-a9ffRange a900-a9ffRange a900-a9ff
Range aa00-aaffRange aa00-aaffRange aa00-aaffRange aa00-aaff
Range ab00-abffRange ab00-abffRange ab00-abffRange ab00-abff
Range ac00-acffRange ac00-acffRange ac00-acffRange ac00-acff
Range ad00-adffRange ad00-adffRange ad00-adffRange ad00-adff
Range ae00-aeffRange ae00-aeffRange ae00-aeffRange ae00-aeff
Range af00-afffRange af00-afffRange af00-afffRange af00-afff
Range b000-b0ffRange b000-b0ffRange b000-b0ffRange b000-b0ff
Range b100-b1ffRange b100-b1ffRange b100-b1ffRange b100-b1ff
Range b200-b2ffRange b200-b2ffRange b200-b2ffRange b200-b2ff
Range b300-b3ffRange b300-b3ffRange b300-b3ffRange b300-b3ff
Range b400-b4ffRange b400-b4ffRange b400-b4ffRange b400-b4ff
Range b500-b5ffRange b500-b5ffRange b500-b5ffRange b500-b5ff
Range b600-b6ffRange b600-b6ffRange b600-b6ffRange b600-b6ff
Range b700-b7ffRange b700-b7ffRange b700-b7ffRange b700-b7ff
Range b800-b8ffRange b800-b8ffRange b800-b8ffRange b800-b8ff
Range b900-b9ffRange b900-b9ffRange b900-b9ffRange b900-b9ff
Range ba00-baffRange ba00-baffRange ba00-baffRange ba00-baff
Range bb00-bbffRange bb00-bbffRange bb00-bbffRange bb00-bbff
Range bc00-bcffRange bc00-bcffRange bc00-bcffRange bc00-bcff
Range bd00-bdffRange bd00-bdffRange bd00-bdffRange bd00-bdff
Range be00-beffRange be00-beffRange be00-beffRange be00-beff
Range bf00-bfffRange bf00-bfffRange bf00-bfffRange bf00-bfff
Range c000-c0ffRange c000-c0ffRange c000-c0ffRange c000-c0ff
Range c100-c1ffRange c100-c1ffRange c100-c1ffRange c100-c1ff
Range c200-c2ffRange c200-c2ffRange c200-c2ffRange c200-c2ff
Range c300-c3ffRange c300-c3ffRange c300-c3ffRange c300-c3ff
Range c400-c4ffRange c400-c4ffRange c400-c4ffRange c400-c4ff
Range c500-c5ffRange c500-c5ffRange c500-c5ffRange c500-c5ff
Range c600-c6ffRange c600-c6ffRange c600-c6ffRange c600-c6ff
Range c700-c7ffRange c700-c7ffRange c700-c7ffRange c700-c7ff
Range c800-c8ffRange c800-c8ffRange c800-c8ffRange c800-c8ff
Range c900-c9ffRange c900-c9ffRange c900-c9ffRange c900-c9ff
Range ca00-caffRange ca00-caffRange ca00-caffRange ca00-caff
Range cb00-cbffRange cb00-cbffRange cb00-cbffRange cb00-cbff
Range cc00-ccffRange cc00-ccffRange cc00-ccffRange cc00-ccff
Range cd00-cdffRange cd00-cdffRange cd00-cdffRange cd00-cdff
Range ce00-ceffRange ce00-ceffRange ce00-ceffRange ce00-ceff
Range cf00-cfffRange cf00-cfffRange cf00-cfffRange cf00-cfff
Range d000-d0ffRange d000-d0ffRange d000-d0ffRange d000-d0ff
Range d100-d1ffRange d100-d1ffRange d100-d1ffRange d100-d1ff
Range d200-d2ffRange d200-d2ffRange d200-d2ffRange d200-d2ff
Range d300-d3ffRange d300-d3ffRange d300-d3ffRange d300-d3ff
Range d400-d4ffRange d400-d4ffRange d400-d4ffRange d400-d4ff
Range d500-d5ffRange d500-d5ffRange d500-d5ffRange d500-d5ff
Range d600-d6ffRange d600-d6ffRange d600-d6ffRange d600-d6ff
Range d700-d7ffRange d700-d7ffRange d700-d7ffRange d700-d7ff
Range d800-d8ffRange d800-d8ffRange d800-d8ffRange d800-d8ff
Range d900-d9ffRange d900-d9ffRange d900-d9ffRange d900-d9ff
Range da00-daffRange da00-daffRange da00-daffRange da00-daff
Range db00-dbffRange db00-dbffRange db00-dbffRange db00-dbff
Range dc00-dcffRange dc00-dcffRange dc00-dcffRange dc00-dcff
Range dd00-ddffRange dd00-ddffRange dd00-ddffRange dd00-ddff
Range de00-deffRange de00-deffRange de00-deffRange de00-deff
Range df00-dfffRange df00-dfffRange df00-dfffRange df00-dfff
Range e000-e0ffRange e000-e0ffRange e000-e0ffRange e000-e0ff
Range e100-e1ffRange e100-e1ffRange e100-e1ffRange e100-e1ff
Range e200-e2ffRange e200-e2ffRange e200-e2ffRange e200-e2ff
Range e300-e3ffRange e300-e3ffRange e300-e3ffRange e300-e3ff
Range e400-e4ffRange e400-e4ffRange e400-e4ffRange e400-e4ff
Range e500-e5ffRange e500-e5ffRange e500-e5ffRange e500-e5ff
Range e600-e6ffRange e600-e6ffRange e600-e6ffRange e600-e6ff
Range e700-e7ffRange e700-e7ffRange e700-e7ffRange e700-e7ff
Range e800-e8ffRange e800-e8ffRange e800-e8ffRange e800-e8ff
Range e900-e9ffRange e900-e9ffRange e900-e9ffRange e900-e9ff
Range ea00-eaffRange ea00-eaffRange ea00-eaffRange ea00-eaff
Range eb00-ebffRange eb00-ebffRange eb00-ebffRange eb00-ebff
Range ec00-ecffRange ec00-ecffRange ec00-ecffRange ec00-ecff
Range ed00-edffRange ed00-edffRange ed00-edffRange ed00-edff
Range ee00-eeffRange ee00-eeffRange ee00-eeffRange ee00-eeff
Range ef00-efffRange ef00-efffRange ef00-efffRange ef00-efff
Range f000-f0ffRange f000-f0ffRange f000-f0ffRange f000-f0ff
Range f100-f1ffRange f100-f1ffRange f100-f1ffRange f100-f1ff
Range f200-f2ffRange f200-f2ffRange f200-f2ffRange f200-f2ff
Range f300-f3ffRange f300-f3ffRange f300-f3ffRange f300-f3ff
Range f400-f4ffRange f400-f4ffRange f400-f4ffRange f400-f4ff
Range f500-f5ffRange f500-f5ffRange f500-f5ffRange f500-f5ff
Range f600-f6ffRange f600-f6ffRange f600-f6ffRange f600-f6ff
Range f700-f7ffRange f700-f7ffRange f700-f7ffRange f700-f7ff
Range f800-f8ffRange f800-f8ffRange f800-f8ffRange f800-f8ff
Range f900-f9ffRange f900-f9ffRange f900-f9ffRange f900-f9ff
Range fa00-faffRange fa00-faffRange fa00-faffRange fa00-faff
Range fb00-fbffRange fb00-fbffRange fb00-fbffRange fb00-fbff
Range fc00-fcffRange fc00-fcffRange fc00-fcffRange fc00-fcff
Range fd00-fdffRange fd00-fdffRange fd00-fdffRange fd00-fdff
Range fe00-feffRange fe00-feffRange fe00-feffRange fe00-feff
Raw outputRaw outputRaw outputRaw output
Raw weaverRaw weaverRaw weaverRaw weaver
Reference ProcessorReference ProcessorReference ProcessorReference Processor
Reference processorReference processorReference processorReference processor
Register TestRegister TestRegister TestRegister Test
RepresentationRepresentationRepresentationRepresentation
RequirementsRequerimientosRequirementsRequirements
Reserved SymbolsReserved SymbolsReserved SymbolsReserved Symbols
Run Time Phrase translationRun Time Phrase translationRun Time Phrase translationRun Time Phrase translation
Run the passesRun the passesRun the passesRun the passes
Running InterscriptRunning InterscriptRunning InterscriptRunning Interscript
ScriptingScriptingScriptingScripting
Second SubheadingSecond SubheadingSecond SubheadingSecond Subheading
Second SubsubheadingSecond SubsubheadingSecond SubsubheadingSecond Subsubheading
SectionsSeccionesSectionsSections
Separate compilationSeparate compilationSeparate compilationSeparate compilation
Separating paragraphsSeparating paragraphsSeparating paragraphsSeparating paragraphs
Sequence concatenationSequence concatenationSequence concatenationSequence concatenation
Server InterfaceServer InterfaceServer InterfaceServer Interface
Set versionSet versionSet versionSet version
SetsSetsSetsSets
Setting a RowSetting a RowSetting a RowSetting a Row
Several HeadingsSeveral HeadingsSeveral HeadingsSeveral Headings
ShiftJis MappingShiftJis MappingShiftJis MappingShiftJis Mapping
Simple Disk File SinkSimple Disk File SinkSimple Disk File SinkSimple Disk File Sink
Single Line Python ScriptSingle Line Python ScriptSingle Line Python ScriptSingle Line Python Script
Sink Base ClassSink Base ClassSink Base ClassSink Base Class
Sink DriversSink DriversSink DriversSink Drivers
Software MetricsSoftware MetricsSoftware MetricsSoftware Metrics
SourceSourceSourceSource
Source BaseSource BaseSource BaseSource Base
Source Base ClassSource Base ClassSource Base ClassSource Base Class
Source Drivers ModuleSource Drivers ModuleSource Drivers ModuleSource Drivers Module
Source Drivers SubpackageSource Drivers SubpackageSource Drivers SubpackageSource Drivers Subpackage
Source ListSource ListSource ListSource List
Source TrackingSource TrackingSource TrackingSource Tracking
Source listSource listSource listSource list
Source treeSource treeSource treeSource tree
SourcesFuentesQuellenSources
Special constructionsSpecial constructionsSpecial constructionsSpecial constructions
SpeedupsSpeedupsSpeedupsSpeedups
StackStackStackStack
Stand alone unix/nt mainlineStand alone unix/nt mainlineStand alone unix/nt mainlineStand alone unix/nt mainline
Standard CategoriesStandard CategoriesStandard CategoriesStandard Categories
Standard InputStandard InputStandard InputStandard Input
Standard Output SinkStandard Output SinkStandard Output SinkStandard Output Sink
Standard Protocol RulesStandard Protocol RulesStandard Protocol RulesStandard Protocol Rules
StartComienzoBeginnenStart
Statement of RequirementsStatement of RequirementsStatement of RequirementsStatement of Requirements
Storage DriversStorage DriversStorage DriversStorage Drivers
StringsStringsStringsStrings
Suggested replacement CodeSuggested replacement CodeSuggested replacement CodeSuggested replacement Code
Supported Programming LanguagesSupported Programming LanguagesSupported Programming LanguagesSupported Programming Languages
Syntax HighlightingSyntax HighlightingSyntax HighlightingSyntax Highlighting
System Configuration moduleSystem Configuration moduleSystem Configuration moduleSystem Configuration module
Table of ContentsTabla de contenidosInhaltsverzeichnisIndice
Table of classesTable of classesTable of classesTable of classes
Table of contentsTable of contentsTable of contentsTable of contents
Table of contents generatorTable of contents generatorTable of contents generatorTable of contents generator
Table of functionsTable of functionsTable of functionsTable of functions
Table of identifiersTable of identifiersTable of identifiersTable of identifiers
Table of sectionsTable of sectionsTable of sectionsTable of sections
Table of testsTable of testsTable of testsTable of tests
TablesTablesTablesTables
Tag methodTag methodTag methodTag method
Tagged categoryTagged categoryTagged categoryTagged category
Tangler Base classTangler Base classTangler Base classTangler Base class
Tangler BugsTangler BugsTangler BugsTangler Bugs
Tangler ConstructorsTangler ConstructorsTangler ConstructorsTangler Constructors
TanglersTanglersTanglersTanglers
TanglingTanglingTanglingTangling
Tangling codeTangling codeTangling codeTangling code
Tangling partsTangling partsTangling partsTangling parts
Tcl TanglerTcl TanglerTcl TanglerTcl Tangler
Tee SinkTee SinkTee SinkTee Sink
TerminationTerminationTerminationTermination
TestTestTestTest
Test 13: mxToolsTest 13: mxToolsTest 13: mxToolsTest 13: mxTools
Test 15: utf8 round tripTest 15: utf8 round tripTest 15: utf8 round tripTest 15: utf8 round trip
Test 18: Python test testTest 18: Python test testTest 18: Python test testTest 18: Python test test
Test 19: Python diff testTest 19: Python diff testTest 19: Python diff testTest 19: Python diff test
Test 1: A simple testTest 1: A simple testTest 1: A simple testTest 1: A simple test
Test 20: generic getoptions moduleTest 20: generic getoptions moduleTest 20: generic getoptions moduleTest 20: generic getoptions module
Test 24: Python diff testTest 24: Python diff testTest 24: Python diff testTest 24: Python diff test
Test CodeTest CodeTest CodeTest Code
Test ItTest ItTest ItTest It
Test OutputTest OutputTest OutputTest Output
Test Routine 2Test Routine 2Test Routine 2Test Routine 2
Test TokeniserTest TokeniserTest TokeniserTest Tokeniser
Test functionTest functionTest functionTest function
Test moduleTest moduleTest moduleTest module
Test outputTest outputTest outputTest output
Test output verificationTest output verificationTest output verificationTest output verification
Test packageTest packageTest packageTest package
Test python functionTest python functionTest python functionTest python function
Test routine 1Test routine 1Test routine 1Test routine 1
Test sourceTest sourceTest sourceTest source
Test standard categoriesTest standard categoriesTest standard categoriesTest standard categories
TestsTestsPrüfenTests
The Interscript--Lout DefinitionsThe Interscript--Lout DefinitionsThe Interscript--Lout DefinitionsThe Interscript--Lout Definitions
The Lout Weaver InitializationThe Lout Weaver InitializationThe Lout Weaver InitializationThe Lout Weaver Initialization
The Tangler StackThe Tangler StackThe Tangler StackThe Tangler Stack
The Web WeaverThe Web WeaverThe Web WeaverThe Web Weaver
The included chunkThe included chunkThe included chunkThe included chunk
The indentation of my programs is all wrong. Why?The indentation of my programs is all wrong. Why?The indentation of my programs is all wrong. Why?The indentation of my programs is all wrong. Why?
The input frameThe input frameThe input frameThe input frame
The main programThe main programThe main programThe main program
The pass frameThe pass frameThe pass frameThe pass frame
The platform frameThe platform frameThe platform frameThe platform frame
The process frameThe process frameThe process frameThe process frame
The project frameThe project frameThe project frameThe project frame
The site frameThe site frameThe site frameThe site frame
The universal frameThe universal frameThe universal frameThe universal frame
The user frameThe user frameThe user frameThe user frame
These debugging notesThese debugging notesThese debugging notesThese debugging notes
Tokenisable LanguagesTokenisable LanguagesTokenisable LanguagesTokenisable Languages
Tokeniser interfaceTokeniser interfaceTokeniser interfaceTokeniser interface
TokenisersTokenisersTokenisersTokenisers
TopArriba del todoOberseiteTop
Translating HtmlTranslating HtmlTranslating HtmlTranslating Html
TuplesTuplesTuplesTuples
TutorialTutorialTutorialTutorial
UCS-2UCS-2UCS-2UCS-2
UCS-2leUCS-2leUCS-2leUCS-2le
UCS-4UCS-4UCS-4UCS-4
UCS-4LEUCS-4LEUCS-4LEUCS-4LE
URL citationURL citationURL citationURL citation
URL inputURL inputURL inputURL input
UTF-16UTF-16UTF-16UTF-16
UTF-16leUTF-16leUTF-16leUTF-16le
Under development and plannedUnder development and plannedUnder development and plannedUnder development and planned
Undiscriminated UnionUndiscriminated UnionUndiscriminated UnionUndiscriminated Union
Unicode DataUnicode DataUnicode DataUnicode Data
Unified command interfaceUnified command interfaceUnified command interfaceUnified command interface
Unimplemented WeaversUnimplemented WeaversUnimplemented WeaversUnimplemented Weavers
Unit testingUnit testingUnit testingUnit testing
Unit testsUnit testsUnit testsUnit tests
Universal SetUniversal SetUniversal SetUniversal Set
Unix: Make the command line launch script executableUnix: Make the command line launch script executableUnix: Make the command line launch script executableUnix: Make the command line launch script executable
Unpack the archiveUnpack the archiveUnpack the archiveUnpack the archive
UntangleUntangleUntangleUntangle
UpmostArriba del todoUpmostUpmost
Utf-8 Encode/DecodeUtf-8 Encode/DecodeUtf-8 Encode/DecodeUtf-8 Encode/Decode
UtilitiesUtilitiesUtilitiesUtilities
Utility ModulesUtility ModulesUtility ModulesUtility Modules
VersionVersiónVersionVersion
Very Long script sectionsVery Long script sectionsVery Long script sectionsVery Long script sections
Weaver ArchitectureWeaver ArchitectureWeaver ArchitectureWeaver Architecture
Weaver BaseWeaver BaseWeaver BaseWeaver Base
Weaver BugsWeaver BugsWeaver BugsWeaver Bugs
Weaver ControlWeaver ControlWeaver ControlWeaver Control
Weaver FiltersWeaver FiltersWeaver FiltersWeaver Filters
Weaver selection testWeaver selection testWeaver selection testWeaver selection test
WeaversWeaversWeaversWeavers
WeavingWeavingWeavingWeaving
Weaving a documentWeaving a documentWeaving a documentWeaving a document
Web WeaverWeb WeaverWeb WeaverWeb Weaver
What if I just want to print it?What if I just want to print it?What if I just want to print it?What if I just want to print it?
What you needWhat you needWhat you needWhat you need
Where to get itWhere to get itWhere to get itWhere to get it
Why are HTML tags printed verbatim, even by the html weaver?Why are HTML tags printed verbatim, even by the html weaver?Why are HTML tags printed verbatim, even by the html weaver?Why are HTML tags printed verbatim, even by the html weaver?
Why are blank lines ignored?Why are blank lines ignored?Why are blank lines ignored?Why are blank lines ignored?
Why do I get multiple spaces in my document?Why do I get multiple spaces in my document?Why do I get multiple spaces in my document?Why do I get multiple spaces in my document?
Windows def fileWindows def fileWindows def fileWindows def file
Windows launcherWindows launcherWindows launcherWindows launcher
Windows: Make the command line launch script executableWindows: Make the command line launch script executableWindows: Make the command line launch script executableWindows: Make the command line launch script executable
Windows_Cp1250Windows_Cp1250Windows_Cp1250Windows_Cp1250
Windows_Cp1251Windows_Cp1251Windows_Cp1251Windows_Cp1251
Windows_Cp1252Windows_Cp1252Windows_Cp1252Windows_Cp1252
Windows_Cp1253Windows_Cp1253Windows_Cp1253Windows_Cp1253
Windows_Cp1254Windows_Cp1254Windows_Cp1254Windows_Cp1254
Windows_Cp1255Windows_Cp1255Windows_Cp1255Windows_Cp1255
Windows_Cp1256Windows_Cp1256Windows_Cp1256Windows_Cp1256
Windows_Cp1257Windows_Cp1257Windows_Cp1257Windows_Cp1257
Windows_Cp1258Windows_Cp1258Windows_Cp1258Windows_Cp1258
Windows_Cp874Windows_Cp874Windows_Cp874Windows_Cp874
XML WeaverXML WeaverXML WeaverXML Weaver
XML support plannedXML support plannedXML support plannedXML support planned
ac00-d7a3 Hangul Syllablesac00-d7a3 Hangul Syllablesac00-d7a3 Hangul Syllablesac00-d7a3 Hangul Syllables
acquireacquireacquireacquire
attrlistattrlistattrlistattrlist
auto weaverauto weaverauto weaverauto weaver
begin/end blocksbegin/end blocksbegin/end blocksbegin/end blocks
c Tanglerc Tanglerc Tanglerc Tangler
c comment tanglerc comment tanglerc comment tanglerc comment tangler
c string tanglerc string tanglerc string tanglerc string tangler
c++ Tanglerc++ Tanglerc++ Tanglerc++ Tangler
c++ comment tanglerc++ comment tanglerc++ comment tanglerc++ comment tangler
closeclosecloseclose
compiler packagecompiler packagecompiler packagecompiler package
countcountcountcount
d800-db7f High Surrogatesd800-db7f High Surrogatesd800-db7f High Surrogatesd800-db7f High Surrogates
dc00-dfff Low Surrogatesdc00-dfff Low Surrogatesdc00-dfff Low Surrogatesdc00-dfff Low Surrogates
dictdictdictdict
document controldocument controldocument controldocument control
existsexistsexistsexists
extractextractextractextract
f900-faff CJK Compatibility Ideographsf900-faff CJK Compatibility Ideographsf900-faff CJK Compatibility Ideographsf900-faff CJK Compatibility Ideographs
fb00-fb4f Alphabetic Presentation Formsfb00-fb4f Alphabetic Presentation Formsfb00-fb4f Alphabetic Presentation Formsfb00-fb4f Alphabetic Presentation Forms
fb50-fdff Arabic Presentation Forms-Afb50-fdff Arabic Presentation Forms-Afb50-fdff Arabic Presentation Forms-Afb50-fdff Arabic Presentation Forms-A
fe20-fe2f Combining Half Marksfe20-fe2f Combining Half Marksfe20-fe2f Combining Half Marksfe20-fe2f Combining Half Marks
fe30-fe4f CJK Compatibility Formsfe30-fe4f CJK Compatibility Formsfe30-fe4f CJK Compatibility Formsfe30-fe4f CJK Compatibility Forms
fe50-fe6f Small Form Variantsfe50-fe6f Small Form Variantsfe50-fe6f Small Form Variantsfe50-fe6f Small Form Variants
fe70-feff Arabic Presentation Forms-Bfe70-feff Arabic Presentation Forms-Bfe70-feff Arabic Presentation Forms-Bfe70-feff Arabic Presentation Forms-B
ff00-ffef Halfwidth and Fullwidth Formsff00-ffef Halfwidth and Fullwidth Formsff00-ffef Halfwidth and Fullwidth Formsff00-ffef Halfwidth and Fullwidth Forms
fff0-ffff Specialsfff0-ffff Specialsfff0-ffff Specialsfff0-ffff Specials
findattrfindattrfindattrfindattr
forallforallforallforall
getgetgetget
gotogotogotogoto
heading processorheading processorheading processorheading processor
hello methodhello methodhello methodhello method
ifilterifilterifilterifilter
indexindexindexindex
indicesindicesindicesindices
invdictinvdictinvdictinvdict
irangeirangeirangeirange
kernelsoflalr1itemskernelsoflalr1itemskernelsoflalr1itemskernelsoflalr1items
listslistslistslists
lookaheadslookaheadslookaheadslookaheads
mapplymapplymapplymapply
method_mapplymethod_mapplymethod_mapplymethod_mapply
microsoft help weavermicrosoft help weavermicrosoft help weavermicrosoft help weaver
microsoft word weavermicrosoft word weavermicrosoft word weavermicrosoft word weaver
mkntfirstmapmkntfirstmapmkntfirstmapmkntfirstmap
mktfirstmapmktfirstmapmktfirstmapmktfirstmap
modulemodulemodulemodule
mxToolsmxToolsmxToolsmxTools
mxTools C headermxTools C headermxTools C headermxTools C header
mxTools C implementationmxTools C implementationmxTools C implementationmxTools C implementation
napplynapplynapplynapply
newmkntfirstmapnewmkntfirstmapnewmkntfirstmapnewmkntfirstmap
nroff weavernroff weavernroff weavernroff weaver
optimsationoptimsationoptimsationoptimsation
postscript weaverpostscript weaverpostscript weaverpostscript weaver
protocol moduleprotocol moduleprotocol moduleprotocol module
range_lenrange_lenrange_lenrange_len
reference processorreference processorreference processorreference processor
reversereversereversereverse
sectionseccionesectionsezione
section processorsection processorsection processorsection processor
setdictsetdictsetdictsetdict
sizeofsizeofsizeofsizeof
trangetrangetrangetrange
tuplestuplestuplestuples
verbosityverbosityverbosityverbosity
xmapxmapxmapxmap
xmap C implementationxmap C implementationxmap C implementationxmap C implementation
Hope that worked.